BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0324 (556 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 25 0.68 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 1.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 3.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.6 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.8 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.8 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.8 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.6 bits (51), Expect = 0.68 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGRGELYNGYSGREHRTSHPLEAAADRRNPQVRR 364 R E+ H+ RNS+ + G+RS R R + H +E R RR Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSRDRSREYKKDRRYDQLHNVEEKHLRERTSRRR 286 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 266 GRGELYNGYSGREHRTSHPL 325 GRG ++ G+ RE + +PL Sbjct: 53 GRGTIFEGHDDREQPSVYPL 72 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 3.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 309 EPHIHWKPQLIDGI 350 + H+ WKP DGI Sbjct: 101 DSHLSWKPSDFDGI 114 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGR 271 R E+ H+ RNS+ + G+RS R Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSR 255 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGR 271 R E+ H+ RNS+ + G+RS R Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSR 255 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGR 271 R E+ H+ RNS+ + G+RS R Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSR 255 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGR 271 R E+ H+ RNS+ + G+RS R Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSR 255 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 203 RSEEDWHKTRNSF*SIGKRSPGR 271 R E+ H+ RNS+ + G+RS R Sbjct: 233 RYEDSRHEDRNSYRNDGERSCSR 255 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 141 GTTGRLLRGE 170 GTTG +LRGE Sbjct: 16 GTTGNILRGE 25 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 141 GTTGRLLRGE 170 GTTG +LRGE Sbjct: 16 GTTGNILRGE 25 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 141 GTTGRLLRGE 170 GTTG +LRGE Sbjct: 16 GTTGNILRGE 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,170 Number of Sequences: 438 Number of extensions: 2441 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -