BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0323 (529 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59017| Best HMM Match : D-aminoacyl_C (HMM E-Value=5.7) 64 9e-11 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 36 0.016 SB_28818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) 29 1.8 SB_23825| Best HMM Match : C4dic_mal_tran (HMM E-Value=4.9) 29 3.1 SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) 28 4.1 SB_15183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) 27 9.6 >SB_59017| Best HMM Match : D-aminoacyl_C (HMM E-Value=5.7) Length = 332 Score = 63.7 bits (148), Expect = 9e-11 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 6/66 (9%) Frame = +2 Query: 104 PHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSEXLVLSD------RTADDSRST 265 P++IPGY G+CP++KY+IG+T+G TT +L D SV +S VLSD AD R T Sbjct: 47 PYHIPGYCGYCPQFKYQIGETFGRTTSCLLTDNSVAYSGKPVLSDIEPQVPPKADTRRDT 106 Query: 266 VQHRMI 283 +++R I Sbjct: 107 IKNRAI 112 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +1 Query: 355 GFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEWAPVNV 489 G+SG VP GE LTN AL FSSN + + PV + Sbjct: 235 GYSGFVPRYRGLMGEGYPVLTNKALIAFSSNMENMKKIKDLPVTI 279 Score = 32.3 bits (70), Expect = 0.25 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 289 IVNARFRNGDPVYKHPMIPGYEGFSGHVPYGFQRFGESSKKLTNSALCDFSSN 447 I N GD M+PGY +G++P +G S + + SA+ DF N Sbjct: 107 IKNRAISLGDQKLTDQMVPGY---TGYIPKAEHYYGNSYAETSRSAIADFHQN 156 Score = 31.5 bits (68), Expect = 0.44 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 113 IPGYTGHCPEYKYRIGDTYGSTTHKILLD 199 +PGYTG+ P+ ++ G++Y T+ + D Sbjct: 124 VPGYTGYIPKAEHYYGNSYAETSRSAIAD 152 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 113 IPGYTGHCPEYKYRIGDTYGSTT 181 +P +TGH P K+R G T+G +T Sbjct: 301 VPHFTGHVPGEKFRYGMTFGYST 323 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 107 HYIPGYTGHCPEYKYRIGDTYGSTTHKILL 196 H+ GY+G P Y+ +G+ Y T+K L+ Sbjct: 231 HHKSGYSGFVPRYRGLMGEGYPVLTNKALI 260 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 36.3 bits (80), Expect = 0.016 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 119 GYTGHCPEYKYRIGDTYGSTTHKI 190 GY G+CP+ KY G TYG T K+ Sbjct: 634 GYRGYCPQLKYECGHTYGIATDKL 657 >SB_28818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.5 bits (78), Expect = 0.027 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 110 YIPGYTGHCPEYKYRIGDTYGSTTHKILLD 199 ++PGY G P+ ++R GDT+G+ T K D Sbjct: 19 HLPGYAGFRPQQQWRYGDTFGNDTAKYFQD 48 >SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) Length = 1094 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 200 PSVQHSEXLVLSDRTADDSRSTVQHRMIXTS*THVSVM 313 P V+HS L LS T DDS+ + + T+ T SV+ Sbjct: 121 PPVKHSVTLTLSFMTCDDSKGQINQDDMFTTSTESSVL 158 >SB_23825| Best HMM Match : C4dic_mal_tran (HMM E-Value=4.9) Length = 646 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 403 TTRRXVESRTAHDPKTLRILVSW 335 T R+ + S TAHDP++L +W Sbjct: 109 TERKRLRSATAHDPRSLSCFTTW 131 >SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) Length = 274 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 100 PTALYSWVHGSLSRVQVS 153 P A Y W HG+LSR++ S Sbjct: 103 PLAHYPWFHGTLSRIEAS 120 >SB_15183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -3 Query: 293 TMSKSFCAGR*IWSHRPFYRIAPAXLNAARSDREGSCVLSSHTYRRSDTCT 141 T+ +S R + SH R L++ R +C LSSHT R TCT Sbjct: 1007 TLFQSHPVTRTLSSHT-LSRPVTRTLSSHTLSRHVTCTLSSHTLSRHVTCT 1056 >SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) Length = 465 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = -2 Query: 369 MTRKPFVSWYHGMLVNGIAITETCVHDVXIILCWTVD 259 + ++PF+ YH +LVN + + C + V +I+ T++ Sbjct: 210 LNKRPFI--YHQLLVNEVHASVHCFNRVILIISGTIN 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,598,353 Number of Sequences: 59808 Number of extensions: 330600 Number of successful extensions: 888 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -