BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0323 (529 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.3 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 23 6.3 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 209 QHSEXLVLSDRTADDSRSTV 268 +HSE +LSD T+ R++V Sbjct: 937 RHSERALLSDSTSSSERNSV 956 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 23.0 bits (47), Expect = 6.3 Identities = 17/63 (26%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = -3 Query: 350 YPGIMGCL*TGSPLRKRAFTM--SKSFCAGR*IWSHRPFYRIAPAXLNAARSDREGSCVL 177 Y G + C + +R T+ ++ FC + P+ P SDR GSC Sbjct: 39 YCGHLDCTRVATFKGERFCTLCDTRHFCECKETREPLPYMYACPGTEPCQSSDRLGSCSK 98 Query: 176 SSH 168 S H Sbjct: 99 SMH 101 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,130 Number of Sequences: 2352 Number of extensions: 10709 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -