BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0322 (549 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1007 + 33452774-33452993,33453028-33453122,33453208-334533... 29 2.4 05_01_0576 - 5130589-5131995 29 3.2 10_08_0607 + 19168164-19168358,19168594-19168716,19168791-191689... 28 5.6 05_01_0569 + 5056261-5057712 28 5.6 04_03_0358 - 14856490-14856573,14856829-14856874,14857116-148572... 27 7.5 03_02_0098 + 5608787-5610812,5610956-5611053 27 7.5 06_03_0181 + 17618888-17619125,17621503-17621683,17621765-176219... 27 9.9 05_04_0309 - 20100231-20100307,20100362-20100503,20100588-201009... 27 9.9 05_02_0099 - 6582498-6582725,6583148-6583235,6583437-6583830,658... 27 9.9 >02_05_1007 + 33452774-33452993,33453028-33453122,33453208-33453329, 33453392-33453694,33454657-33454918,33455039-33455140, 33455931-33457151,33457250-33457342 Length = 805 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 399 RLSTFRRVVEKAH*FSSLRLFVELPKKAEH*VGSCKWVKPDPPLSINP 542 ++++ R+ V +A S LR ++ PK V + KW P PP + P Sbjct: 188 KVTSVRQAVRQAPAVSPLRTMIQGPKPDN--VSTQKWTPPPPPSTTRP 233 >05_01_0576 - 5130589-5131995 Length = 468 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 148 GSLSRVQVSDRRYVWLDNTQDPSRSERAAFREAGAIDRTADD 273 G RV V +R W D +DP+ A FR A + R D Sbjct: 102 GGGRRVWVRERSTEWWDRMRDPAACPEAEFRRAFRMPRAVFD 143 >10_08_0607 + 19168164-19168358,19168594-19168716,19168791-19168946, 19169129-19169314,19169467-19169583,19169721-19169774, 19169854-19169925,19170430-19170535,19170658-19170754, 19171090-19171184,19172318-19172420,19172699-19172886, 19174928-19175183,19177187-19177325 Length = 628 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +1 Query: 61 IRPKIFFFEIYNGSGFSQYRPTALYSWVHGSLSRVQVSDRRYVWLDNTQDPSRSERAA 234 + P +F +Y G P+ S S R Q++ +WL Q+P+ S R + Sbjct: 383 VYPDVFMTNLYYGGTRIAGDPSNCSSPAAVSTVRKQIASHISLWLSQCQEPTSSRRTS 440 >05_01_0569 + 5056261-5057712 Length = 483 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 160 RVQVSDRRYVWLDNTQDPSRSERAAFREAGAIDRTADD 273 RV V +R W D +DP+ A FR A + R D Sbjct: 119 RVWVRERSTEWWDRMRDPAACPEADFRRAFRMPRAVFD 156 >04_03_0358 - 14856490-14856573,14856829-14856874,14857116-14857229, 14857366-14857401,14857822-14857946,14858052-14858117, 14858295-14858534,14858900-14859001,14859101-14859138, 14859219-14859321,14859402-14859524,14860666-14860742, 14860853-14860998,14861077-14861246 Length = 489 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 340 PVYKHPMIPGYEGFSGHVPYGFQRFGESSKK 432 P Y HP I E + +P F++ GE+ K+ Sbjct: 266 PCYHHPEIQELEFKNSSLPSSFRKLGETEKR 296 >03_02_0098 + 5608787-5610812,5610956-5611053 Length = 707 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 503 TGAHSVLCLLR*FDEKSQRAELVSFFDDSP 414 +G H LC ++ D + +RA L +FF + P Sbjct: 44 SGCHCFLCAIKEPDARLRRASLAAFFRELP 73 >06_03_0181 + 17618888-17619125,17621503-17621683,17621765-17621906, 17622002-17622071,17622162-17622307,17623382-17623948, 17624558-17624641,17624723-17624797,17625049-17625217, 17625395-17625586,17625662-17626053 Length = 751 Score = 27.1 bits (57), Expect = 9.9 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 355 PMIPGYEGFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEWAPVNG 510 P+ P EG GH + F FG+ S N + +F + + EW+ ++G Sbjct: 339 PLHPSREG--GHTSFTFGGFGKGSSSSQNPSQLEFRT-LDLNSAYEWSAMHG 387 >05_04_0309 - 20100231-20100307,20100362-20100503,20100588-20100967, 20101049-20101076,20101182-20101306,20101402-20101457, 20101709-20101791,20101881-20101949,20102050-20102640 Length = 516 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 419 SRRKSSLIQLSATFRRITEEGRALSGL 499 S R+ L+QLS + + TE GRA++GL Sbjct: 205 SLRRLQLMQLSVSTLKATEIGRAVNGL 231 >05_02_0099 - 6582498-6582725,6583148-6583235,6583437-6583830, 6585855-6585990,6586413-6586931 Length = 454 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 86 KFTMALDLVSIAQPHYIPGYTGHCPEYKYRI 178 +F M ++L+S + Y+ G GHC E +R+ Sbjct: 169 EFEMEVELLSRLRSPYLLGLIGHCSEGGHRL 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,511,310 Number of Sequences: 37544 Number of extensions: 367037 Number of successful extensions: 880 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -