BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0322 (549 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59017| Best HMM Match : D-aminoacyl_C (HMM E-Value=5.7) 61 5e-10 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 36 0.017 SB_28818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_23825| Best HMM Match : C4dic_mal_tran (HMM E-Value=4.9) 29 2.5 SB_31847| Best HMM Match : Sugar_tr (HMM E-Value=4.6e-05) 29 3.3 SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) 28 4.4 SB_51718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_30668| Best HMM Match : NIF3 (HMM E-Value=5.1) 28 5.8 SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) 28 5.8 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 27 7.6 SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_59017| Best HMM Match : D-aminoacyl_C (HMM E-Value=5.7) Length = 332 Score = 61.3 bits (142), Expect = 5e-10 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 6/64 (9%) Frame = +2 Query: 125 PHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLSIERPM------TSRST 286 P++IPGY G+CP++KY+IG+T+G TT +L D SV +S + VLS P T R T Sbjct: 47 PYHIPGYCGYCPQFKYQIGETFGRTTSCLLTDNSVAYSGKPVLSDIEPQVPPKADTRRDT 106 Query: 287 VQHR 298 +++R Sbjct: 107 IKNR 110 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 310 IVNARFRNGDPVYKHPMIPGYEGFSGHVPYGFQRFGESSKKLTNSALCDFSSN 468 I N GD M+PGY +G++P +G S + + SA+ DF N Sbjct: 107 IKNRAISLGDQKLTDQMVPGY---TGYIPKAEHYYGNSYAETSRSAIADFHQN 156 Score = 31.5 bits (68), Expect = 0.47 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTHKILLD 220 +PGYTG+ P+ ++ G++Y T+ + D Sbjct: 124 VPGYTGYIPKAEHYYGNSYAETSRSAIAD 152 Score = 31.5 bits (68), Expect = 0.47 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +1 Query: 376 GFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEWAPV 504 G+SG VP GE LTN AL FSSN + + PV Sbjct: 235 GYSGFVPRYRGLMGEGYPVLTNKALIAFSSNMENMKKIKDLPV 277 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTT 202 +P +TGH P K+R G T+G +T Sbjct: 301 VPHFTGHVPGEKFRYGMTFGYST 323 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 5/52 (9%) Frame = +2 Query: 128 HYIPGYTGHCPEYKYRIGDTYGSTTHKILL--DPSVQHSER---LVLSIERP 268 H+ GY+G P Y+ +G+ Y T+K L+ ++++ ++ L ++IERP Sbjct: 231 HHKSGYSGFVPRYRGLMGEGYPVLTNKALIAFSSNMENMKKIKDLPVTIERP 282 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 140 GYTGHCPEYKYRIGDTYGSTTHKI 211 GY G+CP+ KY G TYG T K+ Sbjct: 634 GYRGYCPQLKYECGHTYGIATDKL 657 >SB_28818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 131 YIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSER 244 ++PGY G P+ ++R GDT+G+ T K D +R Sbjct: 19 HLPGYAGFRPQQQWRYGDTFGNDTAKYFQDKRTAQLKR 56 >SB_23825| Best HMM Match : C4dic_mal_tran (HMM E-Value=4.9) Length = 646 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 424 TTRRNVESRTAHDPKTLRILVSW 356 T R+ + S TAHDP++L +W Sbjct: 109 TERKRLRSATAHDPRSLSCFTTW 131 >SB_31847| Best HMM Match : Sugar_tr (HMM E-Value=4.6e-05) Length = 549 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -1 Query: 354 MLVNGIAITETCVHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLGSRRILCVVEPYVS 181 ML G+A+T + ++ + + + EV +I ST+L C T +R +V YVS Sbjct: 347 MLSAGLALTSKSILNIAWLTIYLIGSEVFPTTIRSTALGMCSTF--QRCGALVAGYVS 402 >SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) Length = 274 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 121 PTALYSWVHGSLSRVQVS 174 P A Y W HG+LSR++ S Sbjct: 103 PLAHYPWFHGTLSRIEAS 120 >SB_51718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1602 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 143 YTGHCPEYKYRIGDTYGSTTHKILLDPSVQH----SERLVLSIERPMTSRSTVQH 295 YT + Y YR+ + GS +P +QH +R + IER + +R +H Sbjct: 311 YTNNTKNYAYRLREYDGSWLEGRFYEPELQHVSLDEQRDLFRIERVIRTRGKGRH 365 >SB_30668| Best HMM Match : NIF3 (HMM E-Value=5.1) Length = 1318 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 143 YTGHCPEYKYRIGDTYGSTTHKILLDPSVQH----SERLVLSIERPMTSRSTVQH 295 YT + Y YR+ + GS +P +QH +R + IER + +R +H Sbjct: 107 YTNNTKNYAYRLREYDGSWLEGRFYEPELQHVSLDEQRDLFRIERVIRTRGKGRH 161 >SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) Length = 465 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/40 (27%), Positives = 25/40 (62%) Frame = -1 Query: 390 MTRKPFVSWYHGMLVNGIAITETCVHDVYLVLCWTVDLEV 271 + ++PF+ YH +LVN + + C + V L++ T++ ++ Sbjct: 210 LNKRPFI--YHQLLVNEVHASVHCFNRVILIISGTINRDL 247 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 27.5 bits (58), Expect = 7.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 352 ACKRDRHYGNVRSRCLSRSVLDG 284 +C D+H+ R C+S+ ++DG Sbjct: 148 SCPMDKHHVETREACVSKGLIDG 170 >SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 27.5 bits (58), Expect = 7.6 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 10/76 (13%) Frame = -1 Query: 366 WYHGMLVNGIAITETCV-----HDVYLVLCWTVDLEVIGRSIDSTSLSECCTLGSRRILC 202 WYHG L N + T V DV V W V G + +T L C ++ + LC Sbjct: 31 WYHGQLGNSVINTVQIVPRYHLQDVLRVGEWVFGGAVCGFWVTTTILCGCASVLN---LC 87 Query: 201 VV--EPYV---SPIRY 169 VV + YV SP+ Y Sbjct: 88 VVSWDRYVTVTSPLNY 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,141,090 Number of Sequences: 59808 Number of extensions: 421456 Number of successful extensions: 1170 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -