BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0322 (549 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT012323-1|AAS77448.1| 323|Drosophila melanogaster AT25213p pro... 65 7e-11 BT001366-1|AAN71121.1| 323|Drosophila melanogaster AT30609p pro... 65 7e-11 AE013599-1255|AAF58679.2| 323|Drosophila melanogaster CG18335-P... 65 7e-11 BT022411-1|AAY54827.1| 103|Drosophila melanogaster IP08053p pro... 35 0.083 AE013599-1258|AAF58677.1| 94|Drosophila melanogaster CG18336-P... 35 0.083 AY070622-1|AAL48093.1| 380|Drosophila melanogaster RE72803p pro... 29 3.1 AE014296-2722|AAN11749.1| 380|Drosophila melanogaster CG4753-PB... 29 3.1 AE014296-2721|AAF49473.1| 380|Drosophila melanogaster CG4753-PA... 29 3.1 BT003783-1|AAO41464.1| 994|Drosophila melanogaster LP02833p pro... 28 7.2 AE014297-4681|AAS65233.2| 179|Drosophila melanogaster CG33483-P... 28 7.2 AE014297-1651|AAF54925.1| 988|Drosophila melanogaster CG8773-PA... 28 7.2 AF200422-1|AAF24340.1| 638|Drosophila melanogaster Short stop/K... 28 9.6 AE014134-8|AAF51569.1| 557|Drosophila melanogaster CG2657-PA pr... 28 9.6 AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-P... 28 9.6 AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-P... 28 9.6 >BT012323-1|AAS77448.1| 323|Drosophila melanogaster AT25213p protein. Length = 323 Score = 64.9 bits (151), Expect = 7e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +1 Query: 376 GFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEW 495 G+SGH+P RFGES+K LTN ALC FS +R+ W Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTW 246 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 289 PAQNEIDIVNARFRNGDPVYKHPMIPGYEGF 381 P + E+ I+ R D VY+HP++PGY GF Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAGF 94 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >BT001366-1|AAN71121.1| 323|Drosophila melanogaster AT30609p protein. Length = 323 Score = 64.9 bits (151), Expect = 7e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +1 Query: 376 GFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEW 495 G+SGH+P RFGES+K LTN ALC FS +R+ W Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTW 246 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 289 PAQNEIDIVNARFRNGDPVYKHPMIPGYEGF 381 P + E+ I+ R D VY+HP++PGY GF Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAGF 94 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >AE013599-1255|AAF58679.2| 323|Drosophila melanogaster CG18335-PA protein. Length = 323 Score = 64.9 bits (151), Expect = 7e-11 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 101 LDLVSIAQPHYIPGYTGHCPEYKYRIGDTYGSTTHKILLDPSVQHSERLVLS 256 +D +PH +PGYTGHC + + R+G TYG THK+L+DP + H+ L+++ Sbjct: 1 MDHAITPEPHLVPGYTGHCAQNRDRVGRTYGRQTHKLLIDPCIYHAPELIVA 52 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +1 Query: 376 GFSGHVPYGFQRFGESSKKLTNSALCDFSSNYRRRQSTEW 495 G+SGH+P RFGES+K LTN ALC FS +R+ W Sbjct: 207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTW 246 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 289 PAQNEIDIVNARFRNGDPVYKHPMIPGYEGF 381 P + E+ I+ R D VY+HP++PGY GF Sbjct: 64 PTEQELKILRTREGLVDSVYRHPILPGYAGF 94 Score = 31.9 bits (69), Expect = 0.59 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTTH 205 +P Y GH P Y+ G TY TT+ Sbjct: 275 VPNYAGHVPGETYKFGRTYAKTTY 298 >BT022411-1|AAY54827.1| 103|Drosophila melanogaster IP08053p protein. Length = 103 Score = 34.7 bits (76), Expect = 0.083 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTT 202 IP Y GH P K+R+G+TYG +T Sbjct: 69 IPRYGGHVPGNKFRVGNTYGRST 91 >AE013599-1258|AAF58677.1| 94|Drosophila melanogaster CG18336-PA protein. Length = 94 Score = 34.7 bits (76), Expect = 0.083 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 134 IPGYTGHCPEYKYRIGDTYGSTT 202 IP Y GH P K+R+G+TYG +T Sbjct: 60 IPRYGGHVPGNKFRVGNTYGRST 82 >AY070622-1|AAL48093.1| 380|Drosophila melanogaster RE72803p protein. Length = 380 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 283 YRPAQNEIDIVNARFRNGDPVYKHPMIPGYEGFSGHVP 396 + PA++E+ + A R G P+ KH +IP +GF+ +P Sbjct: 177 FTPAKHELSVKFAEER-GLPLLKHHLIPRTKGFTTSLP 213 >AE014296-2722|AAN11749.1| 380|Drosophila melanogaster CG4753-PB, isoform B protein. Length = 380 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 283 YRPAQNEIDIVNARFRNGDPVYKHPMIPGYEGFSGHVP 396 + PA++E+ + A R G P+ KH +IP +GF+ +P Sbjct: 177 FTPAKHELSVKFAEER-GLPLLKHHLIPRTKGFTTSLP 213 >AE014296-2721|AAF49473.1| 380|Drosophila melanogaster CG4753-PA, isoform A protein. Length = 380 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 283 YRPAQNEIDIVNARFRNGDPVYKHPMIPGYEGFSGHVP 396 + PA++E+ + A R G P+ KH +IP +GF+ +P Sbjct: 177 FTPAKHELSVKFAEER-GLPLLKHHLIPRTKGFTTSLP 213 >BT003783-1|AAO41464.1| 994|Drosophila melanogaster LP02833p protein. Length = 994 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 318 VHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLG 220 + +Y L WTV + + + T+LS C+LG Sbjct: 761 IEPIYTALTWTVGEDHLDNRLRVTALSAACSLG 793 >AE014297-4681|AAS65233.2| 179|Drosophila melanogaster CG33483-PA protein. Length = 179 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 432 LFRRLAETLKAVRHMTRKPFVSWYHGMLVNGIAITETCVHDVYLVL 295 L+ + KA+RH P S+++G+ + + TC D L++ Sbjct: 88 LYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIV 133 >AE014297-1651|AAF54925.1| 988|Drosophila melanogaster CG8773-PA protein. Length = 988 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 318 VHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLG 220 + +Y L WTV + + + T+LS C+LG Sbjct: 755 IEPIYTALTWTVGEDHLDNRLRVTALSAACSLG 787 >AF200422-1|AAF24340.1| 638|Drosophila melanogaster Short stop/Kakapo isoform C protein. Length = 638 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 357 GMLVNGIAITETCVHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLGSRRI 208 G LV AI + H + + EV+G S++ST S+ G RR+ Sbjct: 106 GALVPAGAIPTSSTHYQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRV 155 >AE014134-8|AAF51569.1| 557|Drosophila melanogaster CG2657-PA protein. Length = 557 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 64 RPKIFFFEIYNGSGFSQYRPTALYSWVHGSLSRVQVS 174 RP + + G P L SW+ G+LSR ++ Sbjct: 7 RPYVLYTHKLYADGLGSNTPVVLTSWIKGALSRPHIN 43 >AE013599-1792|AAF58320.2| 8805|Drosophila melanogaster CG18076-PH, isoform H protein. Length = 8805 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 357 GMLVNGIAITETCVHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLGSRRI 208 G LV AI + H + + EV+G S++ST S+ G RR+ Sbjct: 106 GALVPAGAIPTSSTHYQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRV 155 >AE013599-1791|AAM68562.1| 5160|Drosophila melanogaster CG18076-PC, isoform C protein. Length = 5160 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 357 GMLVNGIAITETCVHDVYLVLCWTVDLEVIGRSIDSTSLSECCTLGSRRI 208 G LV AI + H + + EV+G S++ST S+ G RR+ Sbjct: 106 GALVPAGAIPTSSTHYQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRV 155 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,252,185 Number of Sequences: 53049 Number of extensions: 608413 Number of successful extensions: 1799 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1799 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2089831299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -