BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0321 (415 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0773 + 31654985-31655365,31655486-31655610,31655712-316560... 28 3.4 >02_05_0773 + 31654985-31655365,31655486-31655610,31655712-31656026, 31656145-31656314,31656408-31656751 Length = 444 Score = 27.9 bits (59), Expect = 3.4 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = -3 Query: 326 AGFSVSPXRYHXSACQFKGGIAENIWSP-----YGGVPPFIT--EPAARSTV 192 AG V+P R H + + G ENI Y G P + T EPA S V Sbjct: 233 AGDGVAPGRLHVARAMVEAGYVENIRQAFSRYLYDGGPAYATGNEPAGESVV 284 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,397,560 Number of Sequences: 37544 Number of extensions: 230898 Number of successful extensions: 465 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 742607976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -