BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesS0321
(415 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
02_05_0773 + 31654985-31655365,31655486-31655610,31655712-316560... 28 3.4
>02_05_0773 +
31654985-31655365,31655486-31655610,31655712-31656026,
31656145-31656314,31656408-31656751
Length = 444
Score = 27.9 bits (59), Expect = 3.4
Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%)
Frame = -3
Query: 326 AGFSVSPXRYHXSACQFKGGIAENIWSP-----YGGVPPFIT--EPAARSTV 192
AG V+P R H + + G ENI Y G P + T EPA S V
Sbjct: 233 AGDGVAPGRLHVARAMVEAGYVENIRQAFSRYLYDGGPAYATGNEPAGESVV 284
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,397,560
Number of Sequences: 37544
Number of extensions: 230898
Number of successful extensions: 465
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 461
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 742607976
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -