Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0321
         (415 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0773 + 31654985-31655365,31655486-31655610,31655712-316560...    28   3.4  

>02_05_0773 +
           31654985-31655365,31655486-31655610,31655712-31656026,
           31656145-31656314,31656408-31656751
          Length = 444

 Score = 27.9 bits (59), Expect = 3.4
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%)
 Frame = -3

Query: 326 AGFSVSPXRYHXSACQFKGGIAENIWSP-----YGGVPPFIT--EPAARSTV 192
           AG  V+P R H +    + G  ENI        Y G P + T  EPA  S V
Sbjct: 233 AGDGVAPGRLHVARAMVEAGYVENIRQAFSRYLYDGGPAYATGNEPAGESVV 284


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,397,560
Number of Sequences: 37544
Number of extensions: 230898
Number of successful extensions: 465
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 461
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 742607976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)