BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0321 (415 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_12157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.5 bits (58), Expect = 4.6 Identities = 22/82 (26%), Positives = 36/82 (43%) Frame = -1 Query: 262 RKTFGAPTEVCHRSSQSRPRVQQFFLGH*PLLTLAMSQLSAGPVPDIRQCVSKNNRVENF 83 RKT PT +S +RP +Q L PL+ + G I +C+ N Sbjct: 302 RKTSAPPTSTTSTASTARPNIQTNRLSTAPLVQSGSTDCCFGVSLRINRCIF------ND 355 Query: 82 IRHFFVL*NAKDRRPVPVKNFL 17 I+H + N+ + + +KNF+ Sbjct: 356 IQHIY---NSNNAQLKNLKNFI 374 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 27.1 bits (57), Expect = 6.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 270 TFKLTSRTMIPVRAHTKPCL 329 T K++SRT +P+ +HT+ L Sbjct: 2052 TIKISSRTRVPIHSHTRDVL 2071 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,811,168 Number of Sequences: 59808 Number of extensions: 257005 Number of successful extensions: 470 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -