BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0321 (415 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 27 0.27 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 24 1.9 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 27.1 bits (57), Expect = 0.27 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 26 LHRNRPPVFSVLQDKKMSNKIFDPVIFGYALS-NIWHWPSTE 148 L N+P V +++ S +P++F YALS I H P T+ Sbjct: 98 LFMNQPDVETLMSVAAYSRDRLNPILFQYALSVAIQHRPDTK 139 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 24.2 bits (50), Expect = 1.9 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 165 RWQCRSSVLGQCQIFDNAYPKITGSKILFDIFLSCKTL 52 R Q R+ VL Q ++D P + G + + + KTL Sbjct: 121 RAQARTPVLYQVMVYDIVRPGVKGKRAPTFLLVDTKTL 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,013 Number of Sequences: 2352 Number of extensions: 8480 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -