BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0320 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.1 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.1 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 30 1.1 SB_51028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_36366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_48390| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) 27 7.6 SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) 27 7.6 >SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 68 SQRTVLWYVVQTTVKKIHAYSHHLFALRTLSIAPD 172 S+R VLW V + ++ + A+S+ LF+L + + PD Sbjct: 172 SERRVLWDVASSKIRAVTAFSNSLFSLNSNAFCPD 206 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 10/59 (16%) Frame = +1 Query: 88 VCGTDYCE-KNPCIQPPLVCPKNTEHRXRHAGKXACC---------PACVTXLGEGATC 234 VCG+D +N C L CPKN +H G A C CVT L + A C Sbjct: 1157 VCGSDKVSYRNKCYMIALNCPKNKYVYVKHEGYCAPCRLAECHKVYAKCVTTLYQTARC 1215 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +1 Query: 82 ALVCGTD-YCEKNPCIQPPLVCPKNTEHRXRHAGKXACCPACVTXLGE 222 A VCGTD + CI C R +HAG+ C V G+ Sbjct: 372 APVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGPCGTLVCTNGK 419 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 88 VCGTDYCE-KNPCIQPPLVCPKNTEHRXRHAGKXACCPACVTXLGEGA-TCK-IYSKELA 258 VCG+D NPC+ C N +H GK +C +G CK I +K Sbjct: 180 VCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSCEQKKCKGTKVCKMIGNKPRC 239 Query: 259 KPPP 270 PP Sbjct: 240 MRPP 243 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = +1 Query: 88 VCGTD-YCEKNPCIQPPLVCPKNTEHRXRHAGKXA-----CCPAC 204 VCG+D NPC+ VC N + R +H G C P C Sbjct: 129 VCGSDGKTYDNPCVFKIAVCQMNGQLRLKHRGACGSRPDKCAPIC 173 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 88 VCGTDYCE-KNPCIQPPLVCPKNTEHRXRHAGKXACCPACVTXLGEGA-TCK-IYSKELA 258 VCG+D NPC+ C N +H GK +C +G CK I +K Sbjct: 37 VCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSCEQKKCKGTKVCKMIGNKPRC 96 Query: 259 KPPP 270 PP Sbjct: 97 MRPP 100 >SB_51028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +3 Query: 252 TGETPSAVCKEPLKCIKRVCTKLV*SFSLAGKYKLAILLSRPVRNIICVRNKIDNNMHCS 431 T E + ++ LK + VC K + G + L ++ V + N+H + Sbjct: 244 TDEKKKTIFRDLLKLLDEVCKKAKCHVLIGGDFNLKYAIAETVVTEVVQERSNQYNLHTN 303 Query: 432 KYRNLKLKNM 461 Y+N K M Sbjct: 304 GYQNKPRKKM 313 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 370 DRSIASLYFPANENDYTSLVQTLLMHLRGSLHTAEGVSPV-PSNKSC 233 D + + Y P E DY ++ H+ GS TA+ PV PS C Sbjct: 1529 DGTCSVSYIPVEEGDYDIHIKFADEHIPGSPFTAKAGRPVDPSKVKC 1575 >SB_36366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 Query: 423 HCSKYRNLKLKNMN 464 HCSKYRN+K K +N Sbjct: 264 HCSKYRNIKQKYIN 277 >SB_48390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 115 NPCIQPPLVCPKNTEHRXRHAGKXACCPACV 207 N C+ P L C N E+R R K CC + + Sbjct: 162 NSCLNPFLYCLTNKEYR-REFTKLLCCKSAI 191 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 139 VCPKNTEHRXRHAGKXACCPACVTXLG-EGATCKIYSKE 252 +CP NT K CPA ++ G +GAT K +E Sbjct: 2764 LCPPNTYQDQEQQSKCHMCPAGLSTFGLQGATSKDQCRE 2802 >SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) Length = 340 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 139 VCPKNTEHRXRHAGKXACCPACVTXLG-EGATCKIYSKE 252 +CP NT K CPA ++ G +GAT K +E Sbjct: 65 LCPPNTYQDQEQQSKCHMCPAGLSTFGLQGATSKDQCRE 103 >SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) Length = 515 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/52 (30%), Positives = 20/52 (38%) Frame = +1 Query: 25 NENVDFYNAGGMRCXTAYGALVCGTDYCEKNPCIQPPLVCPKNTEHRXRHAG 180 ++NV+ N GG YG C YC N P C N R + G Sbjct: 88 SQNVNVRNCGGFYIYEIYGTPTCNLRYC-GNGGAGPSSCCNWNENIRILNCG 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,968,461 Number of Sequences: 59808 Number of extensions: 338824 Number of successful extensions: 879 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -