BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0319 (558 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0084 + 9696368-9696554,9696648-9696718,9696821-9696901,969... 29 3.3 >11_03_0084 + 9696368-9696554,9696648-9696718,9696821-9696901, 9697139-9697206,9697335-9697437,9700422-9700567, 9700686-9700803,9701693-9701797,9702333-9702434, 9702518-9702655,9703475-9703603,9703682-9703762, 9703883-9703957,9704861-9705028,9705125-9705242, 9705345-9705409,9705547-9705637,9705801-9705885, 9706006-9706084,9706317-9706414,9707029-9707137, 9707224-9707292,9707770-9707835,9707952-9708041, 9708416-9708526 Length = 850 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 370 GPEEMKAVMTAKDVTCTRVYKVQ*KDSTPRSGVGAADSRTS 492 G + ++ M AKD T +V +V KD S VG ADS+ + Sbjct: 159 GMDVVEMAMWAKDNTTVKVTQVSTKDGPIESLVGEADSQVA 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,479,761 Number of Sequences: 37544 Number of extensions: 291928 Number of successful extensions: 735 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -