BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0319 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 71 3e-14 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 3.9 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 3.9 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 3.9 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 24 3.9 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 3.9 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 23 6.8 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 70.9 bits (166), Expect = 3e-14 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = +2 Query: 56 GKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKF 235 GKKYKM SE FD++M +GVG++ RK N+++PTVEL K+GDEY T S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRSSS 94 Query: 236 KPGEEFE 256 EF+ Sbjct: 95 SWAMEFD 101 Score = 34.3 bits (75), Expect = 0.003 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +1 Query: 256 EDRADGAKVKSVCTFEGNTLKQVQK 330 E+ DG VKSVCTF+GN L QK Sbjct: 102 EETVDGRMVKSVCTFDGNKLIHEQK 126 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 134 KAANAVTPTVELRKDGDEYNLVTSST 211 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 134 KAANAVTPTVELRKDGDEYNLVTSST 211 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 134 KAANAVTPTVELRKDGDEYNLVTSST 211 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.8 bits (49), Expect = 3.9 Identities = 21/74 (28%), Positives = 33/74 (44%) Frame = -1 Query: 255 SNSSPGLNFISVVLKVEEVTKLYSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFSEE 76 SN+ N ++ V+ V V L P+L + +T + + V M+ K SEE Sbjct: 3 SNAFYSSNTVTWVVAVIGVYCLVFRPALVHAQQSLTQADMDEIAKGMRKVCMSRHKISEE 62 Query: 75 VILYFLPTNSIFID 34 + Y P+ IF D Sbjct: 63 MANY--PSQGIFPD 74 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 3.9 Identities = 21/74 (28%), Positives = 33/74 (44%) Frame = -1 Query: 255 SNSSPGLNFISVVLKVEEVTKLYSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFSEE 76 SN+ N ++ V+ V V L P+L + +T + + V M+ K SEE Sbjct: 3 SNAFYSSNTVTWVVAVIGVYCLVFRPALVHAQQSLTQADMDEIAKGMRKVCMSRPKISEE 62 Query: 75 VILYFLPTNSIFID 34 + Y P+ IF D Sbjct: 63 MANY--PSQGIFPD 74 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 23.0 bits (47), Expect = 6.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 182 DEYNLVTSSTFKTTEMKFKPGEEFERT 262 + Y L TS + + +F P E ERT Sbjct: 63 NNYELNTSERYWSEPKRFNPSRENERT 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,354 Number of Sequences: 2352 Number of extensions: 9936 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -