BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0316 (329 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 38 0.043 UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1... 32 2.1 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 37.9 bits (84), Expect = 0.043 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +2 Query: 113 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXXXXNLLAGNIVS 250 IYGTGGLLTP+VAP+L N++AG+++S Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVIS 62 >UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1; n=2; Caenorhabditis|Rep: Laminin related. see also lmb-protein 1 - Caenorhabditis elegans Length = 1067 Score = 32.3 bits (70), Expect = 2.1 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 76 SCISGKRGRRC--CNIWHWGSXDSISGSRARFQLSGN 180 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 277,173,738 Number of Sequences: 1657284 Number of extensions: 4195737 Number of successful extensions: 6643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6642 length of database: 575,637,011 effective HSP length: 86 effective length of database: 433,110,587 effective search space used: 9961543501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -