BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0316 (329 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 1.6 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 1.6 SB_38919| Best HMM Match : Fumarate_red_D (HMM E-Value=4.7) 28 2.1 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 106 CCNIWHWGSXDSISGSRARFQLSGNSGRKHSRCFTSILRE 225 C ++H G+ + I + R Q+ G+ R C TS+ +E Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 118 WHWGSXDSISGSRARFQLSGNSGRKHSR 201 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_38919| Best HMM Match : Fumarate_red_D (HMM E-Value=4.7) Length = 479 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 145 SGSRARFQLSGNSGRKHSRCFTSILREFTGRQHC 246 +G+ +L NS S F SI+R +TG HC Sbjct: 10 TGAENTTELGSNSSTLLSVLFVSIVRTYTGDGHC 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,734,462 Number of Sequences: 59808 Number of extensions: 143244 Number of successful extensions: 188 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 463065397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -