BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0316 (329 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 26 0.42 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 22 6.9 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 21 9.1 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 21 9.1 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 21 9.1 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 25.8 bits (54), Expect = 0.42 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 28 LRIARREQKLKXHXASSCISGKRGRRCC 111 LR R ++ K H + C G++GR C Sbjct: 125 LRTTRLGRRFKLHSSFICAGGEKGRDTC 152 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 21.8 bits (44), Expect = 6.9 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +1 Query: 106 CCNIWHWGSXDS 141 CC +W W +S Sbjct: 88 CCRLWRWPDLNS 99 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 218 SMLVKQRLCFLPLFPLS*NRAREPLMESXDPQCHILQHR 102 SMLV + P PLS ++++ P ++ H L H+ Sbjct: 38 SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 242 CCRPVNSRSMLVKQRL 195 C R +NSR++LVK L Sbjct: 370 CHRDLNSRNILVKSDL 385 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 107 HRRPRLPLMQLEAXCXFNFCSLRAIRRY 24 HRR R Q+ A C + C+L ++ Y Sbjct: 127 HRRVR---RQVVAECCYQSCTLDTLKSY 151 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 291,282 Number of Sequences: 2352 Number of extensions: 5110 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22910151 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -