BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0315 (557 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6ILW5 Cluster: HDC08196; n=1; Drosophila melanogaster|... 35 1.5 >UniRef50_Q6ILW5 Cluster: HDC08196; n=1; Drosophila melanogaster|Rep: HDC08196 - Drosophila melanogaster (Fruit fly) Length = 136 Score = 34.7 bits (76), Expect = 1.5 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = -2 Query: 496 SLSFFRIFASLDFFFKNFSTAATLLGFDALFDF-PQLEHLAFDLVDIMDTALRQGRTPFE 320 SLS + + + F+F+ T ++ ++ Q+ HL + D ++ LR G PF Sbjct: 34 SLSGYSYMSHIHFYFRKCVTGNGVINSTSVTPSRSQMNHLWWSAFDFVEKLLR-GFWPFA 92 Query: 319 VVFFKHFSGFW 287 F+ FSGFW Sbjct: 93 FCSFECFSGFW 103 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 499,325,029 Number of Sequences: 1657284 Number of extensions: 9359045 Number of successful extensions: 23721 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23712 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 37071859483 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -