BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0304 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pom... 29 0.60 SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharom... 29 0.60 SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4 |S... 29 0.60 SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosa... 27 1.4 SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyce... 27 1.4 SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi... 26 3.2 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 25 5.6 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 25 7.3 SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr ... 25 9.7 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 25 9.7 SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 25 9.7 SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy... 25 9.7 >SPAC212.11 |tlh1||RecQ type DNA helicase|Schizosaccharomyces pombe|chr 1||Partial|Manual Length = 1887 Score = 28.7 bits (61), Expect = 0.60 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +1 Query: 226 RDGKYFIAAVDVENQKYRKTHWNATNTSKMR--MSNSPRAVRDCVASSK*MERE*CKPEG 399 RDGKY IAA+ E KY T W++ M+ ++++ VR +AS M+ E C Sbjct: 1514 RDGKYAIAALFYE--KYDST-WSSYVEDSMKNFLNDNTMCVRSFLASE--MDGE-CVCCA 1567 Query: 400 SLANC 414 S ANC Sbjct: 1568 SFANC 1572 >SPBCPT2R1.08c |tlh2||RecQ type DNA helicase Tlh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 28.7 bits (61), Expect = 0.60 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +1 Query: 226 RDGKYFIAAVDVENQKYRKTHWNATNTSKMR--MSNSPRAVRDCVASSK*MERE*CKPEG 399 RDGKY IAA+ E KY T W++ M+ ++++ VR +AS M+ E C Sbjct: 1514 RDGKYAIAALFYE--KYDST-WSSYVEDSMKNFLNDNTMCVRSFLASE--MDGE-CVCCA 1567 Query: 400 SLANC 414 S ANC Sbjct: 1568 SFANC 1572 >SPAC9G1.13c |||histone acetyltransferase complex subunit Swc4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 28.7 bits (61), Expect = 0.60 Identities = 11/39 (28%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 169 QPWQEWSDHYTCHRYR-CEIRDGKYFIAAVDVENQKYRK 282 + +++W+ T + +R C+ D ++F+ A +N+KY+K Sbjct: 97 EAYEDWNKDETDYLFRLCKDYDLRFFVIADRYDNEKYKK 135 >SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 300 Score = 27.5 bits (58), Expect = 1.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPT 335 +RR LH +P ECHE I++E+V+ P+ Sbjct: 79 KRRIWLHGVLRFHRPLHLFQTSECHELIQEESVKSPS 115 >SPBP8B7.18c |||phosphomethylpyrimidine kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 551 Score = 27.5 bits (58), Expect = 1.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 172 PWQEWSDHYTCHRYRCEIRDG 234 P+Q+W D+Y C Y +R G Sbjct: 478 PYQKWVDNYFCEDYLSAVRRG 498 >SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 26.2 bits (55), Expect = 3.2 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 421 SGNSSPGCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSWHSSAFS 278 S +SSP T SP +S++ + + +S+ SSS S SS+ S Sbjct: 139 SSSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.4 bits (53), Expect = 5.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 255 GCRKPKIPENALECHEYIEDEN 320 G K IP+N EC E + DE+ Sbjct: 1567 GRSKVTIPQNMFECKELVADEH 1588 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 25.0 bits (52), Expect = 7.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 408 ELFPDKPWKGQQNEPNPAXVG 470 + F WK Q NE NP +G Sbjct: 337 DFFTSDEWKNQVNESNPLGMG 357 >SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1237 Score = 24.6 bits (51), Expect = 9.7 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 344 RTARGE--FDILIFDVFVAFQCVFRYFWFSTSTAAMKYFPSL 225 R RG+ FD+ F + F VF+ + A K FPS+ Sbjct: 214 RVNRGQDQFDLSSFPLLKVFSSVFKVAYSKALLDAEKLFPSI 255 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 192 SLHVPPLQMRDQRREILHSCC 254 S+HVPPL + + EI S C Sbjct: 848 SIHVPPLNVPNAEGEIEESVC 868 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 24.6 bits (51), Expect = 9.7 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 403 GCPLVCTILSPFTSTTQRNRAQHVGNSTFSSSMYSW 296 GC L C ILSP R R HV + T +SW Sbjct: 377 GCALSCAILSP----VFRVREFHVHDVTTYPITFSW 408 >SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 3|||Manual Length = 654 Score = 24.6 bits (51), Expect = 9.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 542 CC*IFQETPDPGLATDRCLLDAAHSDXSRI 453 CC FQET G A C L+ + D S + Sbjct: 35 CC--FQETGSTGTANSICTLNDSEDDNSSL 62 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,418,737 Number of Sequences: 5004 Number of extensions: 51788 Number of successful extensions: 169 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -