BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0303 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45330.1 68416.m04894 lectin protein kinase family protein co... 39 0.003 At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transfera... 34 0.073 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 31 0.39 At2g17550.1 68415.m02031 expressed protein 30 1.2 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 1.6 At5g43560.2 68418.m05326 meprin and TRAF homology domain-contain... 29 2.1 At5g43560.1 68418.m05325 meprin and TRAF homology domain-contain... 29 2.1 At3g20310.1 68416.m02573 ethylene-responsive element-binding fam... 29 2.1 At3g51290.1 68416.m05614 proline-rich family protein 29 2.7 At5g66640.1 68418.m08399 LIM domain-containing protein-related c... 28 3.6 At2g39220.1 68415.m04817 patatin family protein similar to patat... 28 3.6 At1g04150.1 68414.m00405 C2 domain-containing protein contains I... 28 3.6 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 28 4.8 At3g12200.1 68416.m01521 protein kinase family protein contains ... 28 4.8 At5g35630.1 68418.m04253 glutamine synthetase (GS2) identical to... 27 6.3 At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putat... 27 6.3 At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putat... 27 6.3 At2g29690.1 68415.m03609 anthranilate synthase, alpha subunit, c... 27 8.3 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 27 8.3 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 27 8.3 >At3g45330.1 68416.m04894 lectin protein kinase family protein contains Serine/Threonine protein kinases active-site signature, Prosite:PS00108; contains Pfam profiles PF00069: Protein kinase domain, PF00139: Legume lectins beta domain, PF00138: Legume lectins alpha domain Length = 682 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = +3 Query: 207 VQEILKDMASQGDYASKHQRWPKPPELSP---IYLPVSPVMPVQPLTSLTLTQTASGPET 377 + E +M Y ++HQR P+ +P + PV +P +TS ++T + SGP Sbjct: 602 IPEARPNMEQVVQYINRHQRLPEFSPNTPGIGVSTPVLMGLPSLAITSSSVTSSVSGPSA 661 Query: 378 SPASDNLSVPSSDT 419 SP+S N S+ S T Sbjct: 662 SPSSANNSMFISHT 675 >At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 33.9 bits (74), Expect = 0.073 Identities = 18/54 (33%), Positives = 32/54 (59%) Frame = -3 Query: 505 ITTQGWSDRVSELTRVDDELIDKIQVLSHVSEEGTERLSEAGEVSGPDAVCVRV 344 I +G++DR+ E + + +D+ ++LSH S +G LS G S +++CV V Sbjct: 323 IIGEGFNDRIRESGMIVRDWVDQWEILSHESVKGF--LSHCGWNSAQESICVGV 374 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 31.5 bits (68), Expect = 0.39 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTS-LTLTQTASGPETSPASDNLSVPSSDTWD 425 P PP SP P PV P+ P TS + T S E+ S + P+ D+ D Sbjct: 811 PPPPVFSP---PPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTPDSED 860 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +3 Query: 276 PPELSPIYLPVSPVM-----PVQPLTSLTLTQTASGPETSPASDNLSVP 407 PP SPIY P PV PV PL T + +S S +S P Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPSSSESGEISTP 850 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -3 Query: 514 STPITTQGWSDRVSELTRVDDELIDKIQVLSHVSEEGTERLSEAGEVSGPDAVCVR 347 STP T SD +EL R +EL ++QV + V EE + + ++ PD V VR Sbjct: 536 STPDVTV--SDE-NELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVFVR 588 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +3 Query: 273 KPPELSPIYLPVSPVM---PVQPLTSLTLTQTASGPETSP 383 KPP SP+ P +P + PVQP T T P T+P Sbjct: 132 KPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTP 171 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +3 Query: 276 PPELSPIYLPVSP-VMP--VQPLTSLTLTQTASGPETSPASDNLSVP 407 PP P Y P +P V P VQP T T T P TSP + P Sbjct: 100 PPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 >At5g43560.2 68418.m05326 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPS 410 P PP P+ P+ P P+ S T TAS + ++ L P+ Sbjct: 759 PAPPMSRPLSAPIIPPTQAAPVISAVQTSTASLARSMSSTGRLGSPT 805 >At5g43560.1 68418.m05325 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1055 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPS 410 P PP P+ P+ P P+ S T TAS + ++ L P+ Sbjct: 759 PAPPMSRPLSAPIIPPTQAAPVISAVQTSTASLARSMSSTGRLGSPT 805 >At3g20310.1 68416.m02573 ethylene-responsive element-binding family protein similar to SP|O80339 Ethylene responsive element binding factor 3 (AtERF3) {Arabidopsis thaliana}; contains Pfam profile PF00847: AP2 domain Length = 244 Score = 29.1 bits (62), Expect = 2.1 Identities = 23/66 (34%), Positives = 28/66 (42%) Frame = +3 Query: 174 DDTDKSIAILNVQEILKDMASQGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLT 353 D KS L + D A D A+++ R PK PI SP P+QPLT L Sbjct: 44 DPLKKSRVWLGTFDSAVDAARAYDTAARNLRGPKAKTNFPI--DCSPSSPLQPLTYLHNQ 101 Query: 354 QTASGP 371 S P Sbjct: 102 NLCSPP 107 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPSSDTWD 425 P PP P P P+ P T+ T T T+S P P S TWD Sbjct: 74 PPPPPPRP---PPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWD 122 >At5g66640.1 68418.m08399 LIM domain-containing protein-related contains low similarity to Pfam profile PF00412: LIM domain Length = 450 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -1 Query: 195 RCFC--QCHRRSPMHVRLRN*LFHHQCRVEFH 106 RC C CHR MH L+ FH C E++ Sbjct: 95 RCLCCFHCHRPFVMHEILKKGKFHIDCYKEYY 126 >At2g39220.1 68415.m04817 patatin family protein similar to patatin-like latex allergen [Hevea brasiliensis][PMID:10589016]; contains patatin domain PF01734 Length = 499 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 399 RDCLKPAKFP--DLTPSV*ELMTLAAAQASPGIPADRWAIIPAVWA 268 +D LKP P DLT S L + A A + G W + A WA Sbjct: 233 KDTLKPVLIPCYDLTSSAPFLFSRADALETDGYDFKLWEVCRATWA 278 >At1g04150.1 68414.m00405 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1012 Score = 28.3 bits (60), Expect = 3.6 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +3 Query: 96 YSDNEIPRDIDDGKASSVISRAWDYVD---DTDKSIAILNVQEILKDMASQGDYASKHQR 266 +++ P ++D+ + SR +D V D +SIA VQ ++ DMASQG+ Sbjct: 888 HAETVFPDELDEEFDTFPTSRGFDVVRMRYDRVRSIAG-RVQTVVGDMASQGERVQALLS 946 Query: 267 WPKP 278 W P Sbjct: 947 WRDP 950 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 141 SSVISRAWDYVDDTDKSIAILNVQEILKDMASQGDYASKH 260 S+V +A VD+ A ++V + KDM GD+ + H Sbjct: 328 SNVFHKACIEVDEEGTEAAAVSVASMTKDMLLMGDFVADH 367 >At3g12200.1 68416.m01521 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 571 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 285 LSPIYLPVSPVMPV 326 LSPIYLPV P+ PV Sbjct: 283 LSPIYLPVFPIKPV 296 >At5g35630.1 68418.m04253 glutamine synthetase (GS2) identical to glutamine synthetase, chloroplast precursor (glutamate-- ammonia ligase, GS2) [Arabidopsis thaliana] SWISS-PROT:Q43127 Length = 430 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 461 PGQLRYSVGPALGCDRGGRIY 523 PGQ + VGP++G D G ++ Sbjct: 253 PGQWEFQVGPSVGIDAGDHVW 273 >At3g23530.1 68416.m02961 cyclopropane fatty acid synthase, putative / CPA-FA synthase, putative similar to cyclopropane synthase [Sterculia foetida] GI:21069167; contains Pfam profiles PF02353: Cyclopropane-fatty-acyl-phospholipid synthase, PF01593: amine oxidase, flavin-containing Length = 867 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +3 Query: 96 YSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQEILKDMASQGD 245 YSD + DID + AW+++ T+K + + IL+++ + Sbjct: 297 YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSE 346 >At3g23510.1 68416.m02960 cyclopropane fatty acid synthase, putative / CPA-FA synthase, putative similar to cyclopropane synthase [Sterculia foetida] GI:21069167; contains Pfam profile PF02353: Cyclopropane-fatty-acyl-phospholipid synthase Length = 867 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +3 Query: 96 YSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQEILKDMASQGD 245 YSD + DID + AW+++ T+K + + IL+++ + Sbjct: 297 YSDIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSE 346 >At2g29690.1 68415.m03609 anthranilate synthase, alpha subunit, component I-2 (ASA2) identical to SP|P32069 Length = 621 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +3 Query: 192 IAILNVQEILKDMASQGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTL 350 ++ +++ + D + A H R P PP + P+S P P TSL L Sbjct: 1 MSAVSISAVKSDFFTVEAIAVTHHRTPHPPHFPSLRFPLSLKSP--PATSLNL 51 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 478 VSELTRVDDELIDKIQVLSHVSEEGTERLSEA-GEVSGPDAVCVRVN 341 +SE +DKI L+ S E RL+EA E++ A+C R++ Sbjct: 138 ISEKNSTIKSYLDKIVKLTDTSSEKEARLAEATAELARSQAMCSRLS 184 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 270 PKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPAS 389 P P LSP P P PL+SL+ + + S P +SP+S Sbjct: 58 PPPLSLSPSSPPPPPPSS-SPLSSLSPSLSPSPPSSSPSS 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,223,779 Number of Sequences: 28952 Number of extensions: 249298 Number of successful extensions: 1058 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -