BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0300 (547 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosacchar... 27 1.8 SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|c... 27 2.4 SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr... 25 7.3 SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr... 25 9.6 >SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 379 PGLNLRTLSTFGHHRNRLCMVKLTGY 302 P ++L + FG N +CM +L GY Sbjct: 234 PSISLENVLAFGDGANDVCMFELAGY 259 >SPBC24C6.08c |||vesicle coat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 26.6 bits (56), Expect = 2.4 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 101 TSKLLHLNGSMSVVYIKAAN-YSSDRKPNLAAYKRGTGGRSSFNGIVATVFGSPDLSDA 274 + K LH+ + + N YSS R A+ GT SFN ++++ GS ++ A Sbjct: 242 SEKFLHIVQFLRISSFNTKNDYSSSRSKTTASSSNGTFASPSFN--ISSLSGSSNIGTA 298 >SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 359 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +1 Query: 370 LGQVLFTPYHLLDEESIAKAVRYSNVVINLVGRDYE 477 L + +P HL+ EE A +Y N + ++ +YE Sbjct: 272 LQKAFLSPDHLIVEEDFYNASKYLNAISDIPFLNYE 307 >SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 24.6 bits (51), Expect = 9.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 230 GIVATVFGSPDLSDAMCATNWEKLVP 307 G++A G D DAM T WE P Sbjct: 202 GMIAIGVGGADAVDAMTNTPWELKAP 227 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,224,963 Number of Sequences: 5004 Number of extensions: 43622 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -