BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0300 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24675| Best HMM Match : No HMM Matches (HMM E-Value=.) 121 4e-28 >SB_24675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 121 bits (291), Expect = 4e-28 Identities = 54/100 (54%), Positives = 74/100 (74%) Frame = +1 Query: 247 FRFTGFVGRYVCNKLGKIGTQLILPYRGDFYDAQRLKVCGDLGQVLFTPYHLLDEESIAK 426 F TGF+GRYV N+LG++GTQL +PYRGD +D + L++ GDLGQ+ F +HL DEESIAK Sbjct: 26 FGATGFLGRYVINRLGRVGTQLTVPYRGDEHDIRHLRLMGDLGQIDFFDFHLKDEESIAK 85 Query: 427 AVRYSNVVINLVGRDYEN*EFQIQ*CSLDGVRRIARICRE 546 V++SNVV+NL+GR +E F + +DG R IA+ +E Sbjct: 86 MVKHSNVVVNLIGRGFETRNFNFEEVHVDGARTIAKAAKE 125 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +2 Query: 197 KRGTGGRSSFNGIVATVFGS 256 K+GTGGRSSFNG+ ATVFG+ Sbjct: 9 KKGTGGRSSFNGVSATVFGA 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,533,333 Number of Sequences: 59808 Number of extensions: 332620 Number of successful extensions: 533 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -