BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0297 (551 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 28 0.23 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 25 1.7 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 25 1.7 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 6.7 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 8.8 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 8.8 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 8.8 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 27.9 bits (59), Expect = 0.23 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 237 QGDYASKHQRWPKPPELSPIYLPVSPVMPVQPLTSLTLTQTASGPETSPASDNLSVP 407 +GDY + PKP +++ + P ++ ++S T GP S A NL P Sbjct: 321 RGDYGILTYKQPKPYKMATAFAAAYPYGQLRIMSSFAFTDFDQGP-PSDAQGNLLSP 376 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 345 TLTQTASGPETSPASDNLSVPSSDTWD 425 T T ASGP T+ S + + PSS D Sbjct: 65 TTTTVASGPVTTTGSTDTTTPSSAPQD 91 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 345 TLTQTASGPETSPASDNLSVPSSDTWD 425 T T ASGP T+ S + + PSS D Sbjct: 75 TTTTVASGPVTTTGSTDTTTPSSAPQD 101 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 6.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 293 HLSAGIPGDACAAANVINSYTDGV 364 H+SAG+P ++ + N DGV Sbjct: 635 HISAGVPQESILGPTLWNVMYDGV 658 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 432 KFCPTCPKKGPRDCL 388 K+CP P P DCL Sbjct: 205 KYCPLKPVITPEDCL 219 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 432 KFCPTCPKKGPRDCL 388 K+CP P P DCL Sbjct: 206 KYCPLKPVITPEDCL 220 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 68 FRRFGNDIVATCAFGIEINSFRDRAN 93 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 284 FRRFGPPLMLTCIIALAGHVLQDLLN 207 FRRFG ++ TC + + +D N Sbjct: 188 FRRFGNDIVATCAFGIEINSFRDRAN 213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,464 Number of Sequences: 2352 Number of extensions: 11869 Number of successful extensions: 27 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -