BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0296 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ... 26 4.2 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 25 9.6 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 25 9.6 >SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 25.8 bits (54), Expect = 4.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 226 WVQRMALSCSRLHGNTSCLFVLSL 155 W+ +AL+ SR +GNT L L L Sbjct: 189 WMDSVALNLSRYYGNTEALSSLPL 212 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 24.6 bits (51), Expect = 9.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 216 GWRSPALAFTETLPV 172 GW+SP+LA TLP+ Sbjct: 30 GWKSPSLAEPFTLPI 44 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 24.6 bits (51), Expect = 9.6 Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = -2 Query: 478 IMGTARIDVVFNHSNASESDQT----KVQNVETNXIKSLGNIGPLKTSATELLAVLNSSG 311 I G+ + +++ ++ D K+Q +E K ++ PL+T EL A + + Sbjct: 1263 ISGSQEVQLLYESNSVLRKDNDAKLGKIQELEKEVEKLNASLNPLQTEINELKAEIGAKT 1322 Query: 310 A 308 A Sbjct: 1323 A 1323 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,334,212 Number of Sequences: 5004 Number of extensions: 46060 Number of successful extensions: 128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -