BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0296 (545 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130630-1|AAI30631.1| 830|Homo sapiens PHC2 protein protein. 31 2.6 AL513327-5|CAI13957.1| 858|Homo sapiens polyhomeotic homolog 2 ... 31 2.6 AL513327-4|CAI13956.1| 464|Homo sapiens polyhomeotic homolog 2 ... 31 2.6 AJ419231-1|CAD11673.1| 858|Homo sapiens polyhomeotic 2 protein. 31 2.6 AK024260-1|BAB14863.1| 126|Homo sapiens protein ( Homo sapiens ... 31 3.5 BC113689-1|AAI13690.1| 917|Homo sapiens chloride channel, calci... 30 6.1 BC113687-1|AAI13688.1| 917|Homo sapiens chloride channel, calci... 30 6.1 AY358470-1|AAQ88834.1| 919|Homo sapiens CLCA4 protein. 30 6.1 AL122002-2|CAI22170.1| 919|Homo sapiens chloride channel, calci... 30 6.1 AF127035-1|AAD48398.1| 917|Homo sapiens calcium-activated chlor... 30 6.1 BC131711-1|AAI31712.1| 676|Homo sapiens GRB2-associated binding... 29 8.0 BC111498-1|AAI11499.1| 435|Homo sapiens serpin peptidase inhibi... 29 8.0 BC089422-1|AAH89422.1| 382|Homo sapiens SERPINA9 protein protein. 29 8.0 BC033256-1|AAH33256.1| 319|Homo sapiens FAM83H protein protein. 29 8.0 AY358700-1|AAQ89063.1| 417|Homo sapiens ASYL692 protein. 29 8.0 AY185496-1|AAO32345.1| 370|Homo sapiens SERPINA11 type a protein. 29 8.0 AK127960-1|BAC87207.1| 886|Homo sapiens protein ( Homo sapiens ... 29 8.0 AB018413-1|BAA76737.1| 676|Homo sapiens Gab2 protein. 29 8.0 AB011143-1|BAA25497.2| 683|Homo sapiens KIAA0571 protein protein. 29 8.0 >BC130630-1|AAI30631.1| 830|Homo sapiens PHC2 protein protein. Length = 830 Score = 31.1 bits (67), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLNR 69 +PG + +C TP PQ G P P+T R Sbjct: 387 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 417 >AL513327-5|CAI13957.1| 858|Homo sapiens polyhomeotic homolog 2 (Drosophila) protein. Length = 858 Score = 31.1 bits (67), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLNR 69 +PG + +C TP PQ G P P+T R Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446 >AL513327-4|CAI13956.1| 464|Homo sapiens polyhomeotic homolog 2 (Drosophila) protein. Length = 464 Score = 31.1 bits (67), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLNR 69 +PG + +C TP PQ G P P+T R Sbjct: 21 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 51 >AJ419231-1|CAD11673.1| 858|Homo sapiens polyhomeotic 2 protein. Length = 858 Score = 31.1 bits (67), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLNR 69 +PG + +C TP PQ G P P+T R Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446 >AK024260-1|BAB14863.1| 126|Homo sapiens protein ( Homo sapiens cDNA FLJ14198 fis, clone NT2RP3002512. ). Length = 126 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 112 GDIDGVPLGQRGVLPGSTQINRKCFREGESRRAPSAGPML 231 G++ V G+R +LP Q+ C +EG SRR G +L Sbjct: 18 GNVTVVQKGERDILPNGQQV-LVCSQEGSSRRCGGQGDLL 56 >BC113689-1|AAI13690.1| 917|Homo sapiens chloride channel, calcium activated, family member 4 protein. Length = 917 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 263 REVVLVTAATGSMGPADGALLLSPSRKHFLFICVEPGS 150 R V LV +GSMG D ++ + KHFL VE GS Sbjct: 305 RIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGS 342 >BC113687-1|AAI13688.1| 917|Homo sapiens chloride channel, calcium activated, family member 4 protein. Length = 917 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 263 REVVLVTAATGSMGPADGALLLSPSRKHFLFICVEPGS 150 R V LV +GSMG D ++ + KHFL VE GS Sbjct: 305 RIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGS 342 >AY358470-1|AAQ88834.1| 919|Homo sapiens CLCA4 protein. Length = 919 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 263 REVVLVTAATGSMGPADGALLLSPSRKHFLFICVEPGS 150 R V LV +GSMG D ++ + KHFL VE GS Sbjct: 305 RIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGS 342 >AL122002-2|CAI22170.1| 919|Homo sapiens chloride channel, calcium activated, family member 4 protein. Length = 919 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 263 REVVLVTAATGSMGPADGALLLSPSRKHFLFICVEPGS 150 R V LV +GSMG D ++ + KHFL VE GS Sbjct: 305 RIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGS 342 >AF127035-1|AAD48398.1| 917|Homo sapiens calcium-activated chloride channel protein 2 protein. Length = 917 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 263 REVVLVTAATGSMGPADGALLLSPSRKHFLFICVEPGS 150 R V LV +GSMG D ++ + KHFL VE GS Sbjct: 305 RIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGS 342 >BC131711-1|AAI31712.1| 676|Homo sapiens GRB2-associated binding protein 2 protein. Length = 676 Score = 29.5 bits (63), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -1 Query: 146 PRCPSGTPSMSPQKGSPASQPYTLNRN*TVAAVSSRRNS--PHTQKRVHR 3 PR P + + +P+ GSP +P + +VAA RRN+ R+HR Sbjct: 353 PRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHR 402 >BC111498-1|AAI11499.1| 435|Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), memb protein. Length = 435 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 167 CVEPGSTPRCPSGTPSMSPQKGSPASQPYTLN 72 CV P + P S P S K +PASQ Y+LN Sbjct: 38 CVSPANAP---SAYPRPSSTKSTPASQVYSLN 66 >BC089422-1|AAH89422.1| 382|Homo sapiens SERPINA9 protein protein. Length = 382 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 167 CVEPGSTPRCPSGTPSMSPQKGSPASQPYTLN 72 CV P + P S P S K +PASQ Y+LN Sbjct: 28 CVSPANAP---SAYPRPSSTKSTPASQVYSLN 56 >BC033256-1|AAH33256.1| 319|Homo sapiens FAM83H protein protein. Length = 319 Score = 29.5 bits (63), Expect = 8.0 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = -1 Query: 158 PGSTPRCPSGTPSMSPQKGSPASQPYTLNRN*TVAAVSSRRNSP 27 PG + R S T QKGSP S Y R V V RR+SP Sbjct: 24 PGFSTRRGSPTTGFIEQKGSPTS-AYPERRGSPVPPVPERRSSP 66 >AY358700-1|AAQ89063.1| 417|Homo sapiens ASYL692 protein. Length = 417 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 167 CVEPGSTPRCPSGTPSMSPQKGSPASQPYTLN 72 CV P + P S P S K +PASQ Y+LN Sbjct: 20 CVSPANAP---SAYPRPSSTKSTPASQVYSLN 48 >AY185496-1|AAO32345.1| 370|Homo sapiens SERPINA11 type a protein. Length = 370 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 167 CVEPGSTPRCPSGTPSMSPQKGSPASQPYTLN 72 CV P + P S P S K +PASQ Y+LN Sbjct: 38 CVSPANAP---SAYPRPSSTKSTPASQVYSLN 66 >AK127960-1|BAC87207.1| 886|Homo sapiens protein ( Homo sapiens cDNA FLJ46072 fis, clone TESTI1000459. ). Length = 886 Score = 29.5 bits (63), Expect = 8.0 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = -1 Query: 158 PGSTPRCPSGTPSMSPQKGSPASQPYTLNRN*TVAAVSSRRNSP 27 PG + R S T QKGSP S Y R V V RR+SP Sbjct: 591 PGFSTRRGSPTTGFIEQKGSPTS-AYPERRGSPVPPVPERRSSP 633 >AB018413-1|BAA76737.1| 676|Homo sapiens Gab2 protein. Length = 676 Score = 29.5 bits (63), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -1 Query: 146 PRCPSGTPSMSPQKGSPASQPYTLNRN*TVAAVSSRRNS--PHTQKRVHR 3 PR P + + +P+ GSP +P + +VAA RRN+ R+HR Sbjct: 353 PRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHR 402 >AB011143-1|BAA25497.2| 683|Homo sapiens KIAA0571 protein protein. Length = 683 Score = 29.5 bits (63), Expect = 8.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -1 Query: 146 PRCPSGTPSMSPQKGSPASQPYTLNRN*TVAAVSSRRNS--PHTQKRVHR 3 PR P + + +P+ GSP +P + +VAA RRN+ R+HR Sbjct: 360 PRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHR 409 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,364,128 Number of Sequences: 237096 Number of extensions: 1852653 Number of successful extensions: 8553 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 8274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8551 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -