BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0295 (551 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45405| Best HMM Match : Calpain_III (HMM E-Value=6.1e-07) 29 3.3 SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) 28 5.8 SB_8631| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_45405| Best HMM Match : Calpain_III (HMM E-Value=6.1e-07) Length = 363 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 243 LLYCYSNFLLNSF--WAKLCLRTPVQNLLS 160 LL +S + NSF W+ LC +P+ +LLS Sbjct: 90 LLIIHSYYTFNSFVAWSSLCTLSPISDLLS 119 >SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) Length = 474 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -1 Query: 437 RHXLQVHVADCPEXDGSALXHHRRXSVHLDPIREFQKCIRSCPLKLLDCTDLLV 276 +H L VH+ C DGSA RR H + R +R ++LLD T +L+ Sbjct: 281 KHRLMVHLWRCAVRDGSA-EAIRRFFQHFEQFR----MLRMWKMQLLDETTILI 329 >SB_8631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -3 Query: 534 SFRKIFCIDLLKVXKSSMLANKTXVFTTDSXEAPXASSTCRRLSR 400 +FR I C+ L+ S LA+K ++ P CRR SR Sbjct: 206 NFRPITCLPLMWKLLSGTLADKIYDHLENAEVLPVEQKGCRRASR 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,171,129 Number of Sequences: 59808 Number of extensions: 252681 Number of successful extensions: 538 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -