BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0294 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 0.77 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 5.4 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.2 bits (50), Expect = 0.77 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = +2 Query: 347 WLXSLWXAFPFRHNGKXARRXEPSSPGGFXW 439 WL ++W F N K E S P + W Sbjct: 83 WLHNIWRPDCFFKNAKKVTFHEMSIPNHYLW 113 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/31 (25%), Positives = 12/31 (38%) Frame = +2 Query: 347 WLXSLWXAFPFRHNGKXARRXEPSSPGGFXW 439 WL ++W F N K + P + W Sbjct: 114 WLKNMWRPDSFFKNAKSVTFQTMTIPNHYLW 144 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,589 Number of Sequences: 438 Number of extensions: 1549 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -