BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0292 (419 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22E76 Cluster: Putative uncharacterized protein; n=3; ... 32 4.1 UniRef50_Q8Y5Y9 Cluster: Lmo1914 protein; n=13; Listeria|Rep: Lm... 32 5.4 >UniRef50_Q22E76 Cluster: Putative uncharacterized protein; n=3; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1654 Score = 32.3 bits (70), Expect = 4.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 56 NTILLFFRTLSCKYL*LFRYXSLKMDMNNPPNQSYWFVLREDQSN 190 N L+FF + S K +Y + + NPP Q+Y+ + +DQ N Sbjct: 1291 NDHLIFFNSQSNKKPIKIKYRKSSLILTNPPPQTYYMHILDDQKN 1335 >UniRef50_Q8Y5Y9 Cluster: Lmo1914 protein; n=13; Listeria|Rep: Lmo1914 protein - Listeria monocytogenes Length = 227 Score = 31.9 bits (69), Expect = 5.4 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = -3 Query: 141 LFISIFNEXYLNNYKYLHDSVLKNRRIVF 55 LF++I + +L N + LHD++L N +IVF Sbjct: 83 LFVNISYDTFLENQEELHDTLLDNGKIVF 111 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 312,609,578 Number of Sequences: 1657284 Number of extensions: 4801001 Number of successful extensions: 10610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10609 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 19389441554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -