Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0290
         (559 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative acetyltr...    23   5.1  
AF230521-1|AAF36974.2|  185|Anopheles gambiae homeobox transcrip...    23   9.0  

>AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative
           acetyltransferase protein.
          Length = 471

 Score = 23.4 bits (48), Expect = 5.1
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -3

Query: 275 PSHAFFTLRHVILRYISLFWPNSKLKSKYWT 183
           P H    L+   +R I+  WP S++ +++W+
Sbjct: 243 PIHRHPELKEQCVRLINTEWPRSRM-ARFWS 272


>AF230521-1|AAF36974.2|  185|Anopheles gambiae homeobox
           transcription factor protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 9.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = -3

Query: 383 RMMLGWFFPYTHF 345
           +MM GW +P++H+
Sbjct: 124 QMMDGWSYPHSHY 136


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 548,467
Number of Sequences: 2352
Number of extensions: 10535
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52142868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)