BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0288 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.04 |rpl1701|rpl17, rpl17-1|60S ribosomal protein L17|Sc... 45 9e-06 SPCC364.03 |rpl1702|rpl17-2, rpl17|60S ribosomal protein L17|Sch... 45 1e-05 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 29 0.64 SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb... 26 6.0 SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 26 6.0 SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe... 25 7.9 >SPBC2F12.04 |rpl1701|rpl17, rpl17-1|60S ribosomal protein L17|Schizosaccharomyces pombe|chr 2|||Manual Length = 187 Score = 45.2 bits (102), Expect = 9e-06 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = +2 Query: 518 KSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKR 649 K KARG+ LR HFKN+ E A I M L++A +L NV E K+ Sbjct: 13 KCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNVKEHKQ 56 Score = 27.5 bits (58), Expect = 2.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 639 KRKECIPFRRFNGG 680 + K+ +PFRRFNGG Sbjct: 53 EHKQAVPFRRFNGG 66 >SPCC364.03 |rpl1702|rpl17-2, rpl17|60S ribosomal protein L17|Schizosaccharomyces pombe|chr 3|||Manual Length = 187 Score = 44.8 bits (101), Expect = 1e-05 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = +2 Query: 518 KSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKR 649 K KARG+ LR HFKN+ E A I M L++A +L NV E K+ Sbjct: 13 KCAKARGAYLRTHFKNSREVAFTINGMNLKKAFIFLDNVKEHKQ 56 Score = 27.5 bits (58), Expect = 2.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 639 KRKECIPFRRFNGG 680 + K+ +PFRRFNGG Sbjct: 53 EHKQAVPFRRFNGG 66 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 29.1 bits (62), Expect = 0.64 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 264 FEVT-LSPFPSDAPLTSMDVERALSFAPRRGTAVFKSSG 377 FEV LS FPSD T +ER+ R GTAVF+S+G Sbjct: 1371 FEVNGLSHFPSDIEDT---IERSHPRIARGGTAVFQSAG 1406 >SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pombe|chr 3|||Manual Length = 323 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374 S+ LTRK +NT R+ + PV ++ + +S PP Sbjct: 228 SIMLTRKLENTTRSDQGYLASPVPFLNGNEPANSGLPP 265 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 432 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEE 298 +S Q N +T NS +++ AE SST + PY S + Sbjct: 155 ISSQQKFHGNDKTLEKNSAKATINKSNSTAETSSTATVEPYDSND 199 >SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe|chr 3|||Manual Length = 396 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374 S+ LTRK +N VR+ + PV ++ D E PP Sbjct: 301 SMMLTRKYENMVRSDMHYSAVPVPFLNGDEPRDYELPP 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,800,701 Number of Sequences: 5004 Number of extensions: 53217 Number of successful extensions: 193 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -