BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0283 (349 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 24 1.9 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 4.3 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/35 (22%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 112 IKIEHCDRNVLSIEKQRSK-**KQIKLCHKSPDII 11 + +E+C++++++I+KQ+ + ++ +L H+ ++I Sbjct: 351 LMVEYCEQDIITIDKQKCEAKDREEQLLHEKQNLI 385 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 4.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 6 FSMMSGDL*HNLICFYYLLRCFSIDKTL 89 F++M GDL H LI F + +KTL Sbjct: 398 FAIMFGDLGHGLILFLLGMWMVLWEKTL 425 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 333,877 Number of Sequences: 2352 Number of extensions: 5254 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -