BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0283 (349 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052119-1|AAK93543.1| 392|Drosophila melanogaster SD07085p pro... 33 0.099 AF220040-1|AAF23824.1| 392|Drosophila melanogaster cathepsin D ... 33 0.099 AE013599-512|AAF59186.1| 392|Drosophila melanogaster CG1548-PA ... 33 0.099 AY071002-1|AAL48624.1| 455|Drosophila melanogaster RE08932p pro... 28 3.7 AE014297-762|AAF54247.2| 455|Drosophila melanogaster CG31259-PA... 28 3.7 >AY052119-1|AAK93543.1| 392|Drosophila melanogaster SD07085p protein. Length = 392 Score = 33.1 bits (72), Expect = 0.099 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 219 QLRNGTI*GAITRMKTARTHFHEVGTELELLRLKYDVTGPSPE 347 Q + G + + + ++AR HF +VGTEL+ LR++Y G PE Sbjct: 22 QEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYG-GGDVPE 63 >AF220040-1|AAF23824.1| 392|Drosophila melanogaster cathepsin D precursor protein. Length = 392 Score = 33.1 bits (72), Expect = 0.099 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 219 QLRNGTI*GAITRMKTARTHFHEVGTELELLRLKYDVTGPSPE 347 Q + G + + + ++AR HF +VGTEL+ LR++Y G PE Sbjct: 22 QEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYG-GGDVPE 63 >AE013599-512|AAF59186.1| 392|Drosophila melanogaster CG1548-PA protein. Length = 392 Score = 33.1 bits (72), Expect = 0.099 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 219 QLRNGTI*GAITRMKTARTHFHEVGTELELLRLKYDVTGPSPE 347 Q + G + + + ++AR HF +VGTEL+ LR++Y G PE Sbjct: 22 QEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYG-GGDVPE 63 >AY071002-1|AAL48624.1| 455|Drosophila melanogaster RE08932p protein. Length = 455 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 196 LFFLALIASSVMALYRVPLHV*KLREPTFMRLAL 297 +F + +++M LYR LH ++PTF +AL Sbjct: 160 VFIMGASVTALMYLYRAGLHKTVAKDPTFKAIAL 193 >AE014297-762|AAF54247.2| 455|Drosophila melanogaster CG31259-PA protein. Length = 455 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 196 LFFLALIASSVMALYRVPLHV*KLREPTFMRLAL 297 +F + +++M LYR LH ++PTF +AL Sbjct: 160 VFIMGASVTALMYLYRAGLHKTVAKDPTFKAIAL 193 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,471,170 Number of Sequences: 53049 Number of extensions: 248956 Number of successful extensions: 370 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 817309116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -