BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0283 (349 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 21 3.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 20 9.6 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 21.4 bits (43), Expect = 3.2 Identities = 7/30 (23%), Positives = 18/30 (60%) Frame = +1 Query: 163 RLLKTTMGKISLFFLALIASSVMALYRVPL 252 R+++ +GK+ + + + V++LY P+ Sbjct: 76 RVIRAKLGKVGVHCMKTTQAVVVSLYEDPI 105 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 19.8 bits (39), Expect = 9.6 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -1 Query: 280 KWVLAVFIRVMAPYIV 233 +WV VFI+V+ +++ Sbjct: 335 RWVRVVFIQVLPRFLL 350 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,404 Number of Sequences: 438 Number of extensions: 1729 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -