BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0279 (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RM68 Cluster: Var1p, putative; n=3; Plasmodium (Vinck... 32 8.9 UniRef50_Q245Q6 Cluster: Putative uncharacterized protein; n=1; ... 32 8.9 >UniRef50_Q7RM68 Cluster: Var1p, putative; n=3; Plasmodium (Vinckeia)|Rep: Var1p, putative - Plasmodium yoelii yoelii Length = 397 Score = 32.3 bits (70), Expect = 8.9 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 17 EYPCNYVYKVFILNTILLFFRTLSCKYL*LFRYFSLKMD 133 +Y NY ++FI+NT+ FF T+S + +YF +++ Sbjct: 244 QYEDNYTKELFIINTLKYFFSTISNSIIQNIKYFEKEIE 282 >UniRef50_Q245Q6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1555 Score = 32.3 bits (70), Expect = 8.9 Identities = 17/69 (24%), Positives = 32/69 (46%) Frame = +1 Query: 271 ENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKIRLLLKLCLEDRFKNINKQKT 450 +N+Q + N+P II ++ Q + C K ++I L LC+ ++N Sbjct: 1372 QNQQSVQFNKPSIIYSSNNPQMESSQCQRIKTFNQTTNQIDLFSILCMNTLLSDLNTYFN 1431 Query: 451 LWHDIASHV 477 ++I S+V Sbjct: 1432 NINNITSNV 1440 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,299,037 Number of Sequences: 1657284 Number of extensions: 10307045 Number of successful extensions: 24344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24335 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -