BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0277 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 26 0.89 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.6 AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 25 1.6 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 2.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 8.3 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 26.2 bits (55), Expect = 0.89 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 158 VQTTFDLHDNTEWQVQDKHTI 220 V T F H EW +DKH I Sbjct: 388 VSTMFSDHSPAEWPTEDKHEI 408 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.4 bits (53), Expect = 1.6 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 371 AESLEINIKNKMFCELFPEYVEEIEQQLKQRQEAMLLNQDSGANEVPL 514 AE L ++ CEL E E EQQ+ ++EA ++ + N+V L Sbjct: 314 AEELYKKLRKHRLCELNREPTEREEQQM--QKEAAVMARTMNLNQVCL 359 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 538 ILTNLFVLVAFVCLTYMVKHVL 603 + TNLF LVA V +++ V HVL Sbjct: 96 VATNLFRLVAVVRISHTVFHVL 117 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.6 bits (51), Expect = 2.7 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -1 Query: 519 WLRGTSFAPLS*FNNIASCRCFNCCSISSTYSGNNS 412 WLRG S +PLS + +S R + C+ SS+ SG +S Sbjct: 32 WLRGNSGSPLSSIS--SSSRNSSSCNNSSS-SGTHS 64 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 8.3 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -2 Query: 68 QYVGRHRFGRNIWYWVILEP 9 +Y+ +HR +W++V +P Sbjct: 1157 RYIPKHRIQYKVWWFVTSQP 1176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,074 Number of Sequences: 2352 Number of extensions: 16592 Number of successful extensions: 239 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 239 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -