BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0265 (338 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0458 + 23808402-23808469,23808800-23809684,23810011-238119... 26 6.6 01_06_0355 + 28657833-28660665,28660762-28661126 26 8.7 >11_06_0458 + 23808402-23808469,23808800-23809684,23810011-23811961, 23812210-23812285,23813064-23813072,23813243-23813335, 23813578-23813581,23813780-23814703,23814926-23815909, 23816073-23816118,23816376-23816951,23817253-23817798, 23817820-23818416 Length = 2252 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 193 MKYMSLDNLNIVEVFQLNLKKLWKKCYIYSNKYCKKL 303 +K + D N+V++FQL+ +KC +Y N C++L Sbjct: 1648 VKLQNSDLNNVVDLFQLSYLTESEKCNLYRN--CQEL 1682 >01_06_0355 + 28657833-28660665,28660762-28661126 Length = 1065 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 109 NQRINLFSLNLPSSIE*YQNLPPAEHSYN 23 N N FS NLP+S+E + L + SYN Sbjct: 611 NLSSNRFSGNLPASLELFSTLTYLDLSYN 639 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,051,189 Number of Sequences: 37544 Number of extensions: 82211 Number of successful extensions: 178 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -