BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0264 (493 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 34 0.055 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 28 4.8 SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) 27 6.4 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 34.3 bits (75), Expect = 0.055 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -1 Query: 472 ENEKHRSNSELQY*AASRRHFPTSEPRQRTASRALEDRGATTRSEAQRAL 323 E EK+ + EL+ S HF E ++R RA+ED+ +SE ++ L Sbjct: 332 EEEKYGKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEKEL 381 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 431 SGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRS 291 S +SP+ P RTT S ++S + R++ R +SS +RR+ Sbjct: 155 SSKSPSPPTNRTTQGESPKTSSSGHGQHSSRTAVRRSASFSSSQRRT 201 >SB_51044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 27.9 bits (59), Expect = 4.8 Identities = 22/104 (21%), Positives = 42/104 (40%), Gaps = 1/104 (0%) Frame = -2 Query: 453 RTASYNIKRPVAD-ISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDS 277 ++ S ++ + V+ +SQ + QP + + RRG R +++ A L Sbjct: 382 QSVSQSVSQSVSQSVSQSVSQSVSQPGQNARDYWIRRGLSYLERYFFLILFNAYLHEQTF 441 Query: 276 VTSNAHRILIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARR 145 HR W++R+ H+ G+ S + TC + R Sbjct: 442 CRWMRHRP--WIYRMLSHIDIKEKGATSEFMMRTHQPTCLVSGR 483 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 366 KTAVPRRGAKLNARSTSILVRGASLGNGDSVTSNAHR 256 KTAVPRRG K S++ R + + + +TS HR Sbjct: 112 KTAVPRRGVK-GLPLNSVIRRLVDVHSSEGMTSARHR 147 >SB_55129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 346 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 459 A+W G E WRL + G++ W L ++ S G Sbjct: 62 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 99 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 346 ASWHRGLQELWRLFAVVVRMLGNVGDWPLNIVTRCSNG 459 A+W G E WRL + G++ W L ++ S G Sbjct: 78 ATWSTGDLEYWRLGVLATWSTGDLEYWRLGVLATWSTG 115 >SB_3978| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-06) Length = 259 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 237 RLTDHLTTASNGSDSSSRGTEYST 166 RLT++ +ASNGSD + E ST Sbjct: 2 RLTNYTLSASNGSDDETSNKEVST 25 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 27.1 bits (57), Expect = 8.4 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 434 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEERRSGTET 279 +S QSPT P + + S C +R R P EER+ TET Sbjct: 338 VSPQSPTQPQYYNKSTSFFDSI---SCEANDRDKNRKAHPSWQEERKLNTET 386 >SB_12671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 339 SLRVVAPRSSRALEAVRCRGSDVGKCRRLAA*YCNSLFERC 461 ++RV+APR + A E S+ C R AA + E C Sbjct: 57 NIRVIAPRKATASELAAFHSSEYVNCMRRAAEAVSDGSEEC 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,949,823 Number of Sequences: 59808 Number of extensions: 273909 Number of successful extensions: 819 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -