BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0260 (299 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 42 7e-05 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.2 SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) 25 8.6 SB_23703| Best HMM Match : TTL (HMM E-Value=0) 25 8.6 SB_51790| Best HMM Match : TTL (HMM E-Value=0) 25 8.6 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 42.3 bits (95), Expect = 7e-05 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +2 Query: 74 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVN 181 ARP+++V++E E+ LP VFKAPIRPDLVN Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVN 35 Score = 33.5 bits (73), Expect = 0.032 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 186 VHVSMSKNSXQPYCVTRRLVTK-PXRIMGYGRAVARIPR 299 VH +++KN QPY V + + G GRAVARIPR Sbjct: 37 VHSNIAKNKRQPYAVNKLAGHQTSAESWGTGRAVARIPR 75 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 1.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 141 GRGLAAPCTVSLFSEYTDTKGRATDRLI 58 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) Length = 711 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 174 RSGRMGALNTNGRGLAAPCTVSLFSEYTDTKG 79 + G +T+G L +PC SLF + D G Sbjct: 437 QQGNSQVCSTDGVTLQSPCHASLFHRHVDYPG 468 >SB_23703| Best HMM Match : TTL (HMM E-Value=0) Length = 657 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 50 SSEMSLSVARPLVSVYSEKSETVQGAAKPL 139 SS +S S RP + S K+ +++ A KPL Sbjct: 346 SSHLSKSNVRPKSQLLSSKNHSLRSALKPL 375 >SB_51790| Best HMM Match : TTL (HMM E-Value=0) Length = 536 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 50 SSEMSLSVARPLVSVYSEKSETVQGAAKPL 139 SS +S S RP + S K+ +++ A KPL Sbjct: 346 SSHLSKSNVRPKSQLLSSKNHSLRSALKPL 375 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,804,093 Number of Sequences: 59808 Number of extensions: 156275 Number of successful extensions: 288 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 352102492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -