BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0259 (349 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608,272... 27 4.0 02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,290... 27 4.0 04_03_0985 - 21438036-21438116,21438373-21438495,21438903-214389... 26 7.1 12_02_0315 - 17417161-17417401,17419426-17419616 26 9.3 01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 26 9.3 >12_01_0357 + 2720860-2721066,2721169-2721384,2721481-2723608, 2723699-2724124,2724242-2724546,2724660-2724823, 2724899-2724980 Length = 1175 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 148 GSRARFQLSGNSGRKHSRCCTS 213 GSRA F+ NS +KHS+ C + Sbjct: 865 GSRALFEGGFNSSQKHSKSCAA 886 >02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475, 2907650-2907790,2907870-2908043,2908577-2908851, 2909592-2909755,2910409-2910536,2910628-2910734, 2911747-2911880,2912266-2912441,2912530-2914257, 2915084-2915239,2915328-2915486,2915581-2915751, 2915931-2916047,2916417-2916473,2916565-2916680, 2916790-2916916,2917862-2917945 Length = 2056 Score = 27.1 bits (57), Expect = 4.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 279 GGYHGSSSHCDTMLP 235 G +HG +SHC T+LP Sbjct: 208 GFHHGGTSHCRTLLP 222 >04_03_0985 - 21438036-21438116,21438373-21438495,21438903-21438995, 21439176-21439388,21439589-21439687,21440248-21440317, 21442549-21442619,21442817-21442954,21443034-21443132, 21444061-21444144,21444268-21444324,21444594-21444683, 21444886-21445026,21445778-21445882,21445962-21446114, 21446215-21446316,21446404-21446562,21447039-21447222, 21447336-21447418,21447523-21447588,21447736-21447793, 21447903-21448003,21448269-21448355,21449063-21449185, 21449285-21449364,21449857-21450066,21450159-21450270, 21450709-21450927,21451356-21451726,21451866-21451965, 21452544-21452752,21453232-21453337,21453435-21453767 Length = 1439 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 127 GSVDSISGSRARFQLSGNSGRKHSRCCTSI-LRKFSG 234 GS DS+ G + R + N K C T I LRK SG Sbjct: 668 GSKDSLVGYQVRLDSARNERTKLLFCTTGILLRKLSG 704 >12_02_0315 - 17417161-17417401,17419426-17419616 Length = 143 Score = 25.8 bits (54), Expect = 9.3 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 109 CNIWHWGSVDSISGSRARFQLSGNSGRKHSRC 204 C IW ++ ++ G+++ F L+G RC Sbjct: 16 CGIWQKAAMVALQGNKSWFGLAGGGATVRLRC 47 >01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 Length = 80 Score = 25.8 bits (54), Expect = 9.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 214 CLCSSGCASCRYS 176 C C +GC C+YS Sbjct: 14 CQCGNGCGGCKYS 26 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,418,412 Number of Sequences: 37544 Number of extensions: 137749 Number of successful extensions: 253 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -