BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0259 (349 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15840.1 68417.m02409 expressed protein 29 0.64 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 28 2.0 At5g11040.1 68418.m01290 expressed protein weak similarity to hy... 26 7.9 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 0.64 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 142 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 234 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 52 KLKEHGASSCISGKXXRRCCNIWHWGSVDSISG 150 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g11040.1 68418.m01290 expressed protein weak similarity to hypercellular protein [Aspergillus nidulans] GI:9309269 Length = 1186 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 118 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSG 234 WH G DS + + +GN+GR S+L ++G Sbjct: 773 WHVGPTDSDNTMSSGRNAAGNTGRPKDGTSPSLLIHYAG 811 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,497,777 Number of Sequences: 28952 Number of extensions: 103054 Number of successful extensions: 195 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -