BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0258 (399 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 25 4.3 SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su... 25 4.3 SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch... 25 5.7 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 25.0 bits (52), Expect = 4.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 376 TASRXLEDRGATTRSEAQRAL 314 +AS LEDR A ++EAQR + Sbjct: 1221 SASSNLEDRAARIKAEAQRRM 1241 >SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Sum3|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 25.0 bits (52), Expect = 4.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 335 ERSSTRALRPYSSEERRSGTETX*LQTPSQFSFGYGG 225 ++ S A +E S + QTPS+FS YGG Sbjct: 37 DKPSAGAAPAVGDDESVSSRGSSRSQTPSEFSSNYGG 73 >SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1480 Score = 24.6 bits (51), Expect = 5.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 13 SSGTSSIPKFHSSLQDLKQPSLQEPR 90 S T+S K H S LK+ S EPR Sbjct: 255 SDETNSFSKLHQSQFGLKEESSHEPR 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,362,571 Number of Sequences: 5004 Number of extensions: 19528 Number of successful extensions: 49 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -