BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0252 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) 29 1.9 SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09) 29 1.9 SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33) 29 3.3 SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) 29 3.3 SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4) 29 3.3 SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) 28 4.4 SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8) 28 4.4 SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 27 7.6 SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_28941| Best HMM Match : PI3_PI4_kinase (HMM E-Value=2.8026e-45) Length = 2022 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 292 SGREHRTSHPLEAAADRRNPQVRRQGPHD 378 SG+ TSHPL + + + Q++RQ HD Sbjct: 1862 SGQVCNTSHPLHSLQAKFDEQIKRQADHD 1890 >SB_48429| Best HMM Match : PI3_PI4_kinase (HMM E-Value=7.7e-09) Length = 1423 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 292 SGREHRTSHPLEAAADRRNPQVRRQGPHD 378 SG+ TSHPL + + + Q++RQ HD Sbjct: 250 SGQVCNTSHPLHSLQAKFDEQIKRQADHD 278 >SB_51745| Best HMM Match : DPRP (HMM E-Value=0.33) Length = 352 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466 PQL+DG+L+ G R+ +P P L + + + VT ++ +L Sbjct: 220 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 266 >SB_35583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466 PQL+DG+L+ G R+ +P P L + + + VT ++ +L Sbjct: 727 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 773 >SB_34676| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-13) Length = 1012 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466 PQL+DG+L+ G R+ +P P L + + + VT ++ +L Sbjct: 945 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 991 >SB_51743| Best HMM Match : DPRP (HMM E-Value=0.4) Length = 281 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP-RASAPPGLRPNEIIDQFHVTNFNVRL 466 PQL+DG+L+ G R+ +P P L + + + VT ++ +L Sbjct: 233 PQLVDGVLRVGGRIDRADIPWETKHPIILDHGQDVTRLIVTEYHQKL 279 >SB_10901| Best HMM Match : SAM_1 (HMM E-Value=2.5e-09) Length = 1472 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +1 Query: 313 SHPLEAAADRRNPQVRRQGPHDVSAQSFCSARTTPQRDYRPVP 441 SHPL NP+ + P S + TT QRD P P Sbjct: 802 SHPLAPFTSESNPRPETKVPITTIGASTSAEVTTSQRDLMPSP 844 >SB_947| Best HMM Match : Phage_term_smal (HMM E-Value=2.8) Length = 237 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP 388 PQL+DG+L+ G R+ LP Sbjct: 124 PQLVDGVLRVGGRIDKADLP 143 >SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 1144 PQLVDGVLRVGGRIDRADIPWETKHP 1169 >SB_1692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLPRASAPP 406 PQL+DG+L+ G R+ +P + P Sbjct: 150 PQLVDGVLRVGGRIDRADIPWETKHP 175 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 27.5 bits (58), Expect = 7.6 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +1 Query: 244 SIGTRSPGRGELYNGYSGR-EHRTSHPLE-AAADRRNPQVRRQGPHDVSAQSFCSARTTP 417 S+ + SP +LY R + + S+P E R +VR Q A + R TP Sbjct: 372 SVVSFSPRAAKLYTKTGQRYKQKHSYPAEIGVGSRMYLEVRVQSNDSKLAVAPLHCRATP 431 Query: 418 QRDYRPVPRHQF 453 Y +PR+ F Sbjct: 432 TSGYEDMPRYVF 443 >SB_4089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP 388 PQL+DG+L+ G R+ LP Sbjct: 176 PQLVDGMLRVGGRIDRADLP 195 >SB_24095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1162 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 329 PQLIDGILKYGDRVHTMSLP 388 PQL+DG+L+ G R+ +P Sbjct: 901 PQLVDGVLRVGGRIDRADIP 920 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,649,921 Number of Sequences: 59808 Number of extensions: 230918 Number of successful extensions: 689 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -