BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0251 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 23 2.0 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 23 2.0 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 21 8.2 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 9 SILFPDTAYYD*HITAGMSXSCYRFT 86 S L PD+ ++ HIT C + T Sbjct: 54 SCLTPDSVFFKSHITEAFQTQCKKCT 79 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 9 SILFPDTAYYD*HITAGMSXSCYRFT 86 S L PD+ ++ HIT C + T Sbjct: 54 SCLTPDSVFFKSHITEAFQTQCKKCT 79 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 21.0 bits (42), Expect = 8.2 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -3 Query: 258 RFCXSVMVRSSFI*PQVTSCVMKLCPVFVXLSVCILKKICL 136 RFC +V+ + I CV +L + VC+ + CL Sbjct: 52 RFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCL 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,928 Number of Sequences: 438 Number of extensions: 1914 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -