BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0249 (479 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 1.1 UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein precur... 33 2.5 UniRef50_Q16KA1 Cluster: Putative uncharacterized protein; n=1; ... 32 7.7 >UniRef50_A4QTL6 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 699 Score = 34.7 bits (76), Expect = 1.1 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 246 VLIWVWRLTDHLTTASNGSDS-SSRGTEYSTTCRTARRAYSKARMACDT 103 VLIW RLT +L AS G D+ + T +STTC S+ + CDT Sbjct: 422 VLIWTGRLTKYLAGASIGHDNINFYNTPFSTTCTCCT---SRLKDLCDT 467 >UniRef50_Q0LHU3 Cluster: Putative uncharacterized protein precursor; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Putative uncharacterized protein precursor - Herpetosiphon aurantiacus ATCC 23779 Length = 472 Score = 33.5 bits (73), Expect = 2.5 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -3 Query: 336 GAKLNARSTSXXVRGXSLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSD 187 GAK ++ T+ V +G G +V A A LI V R+T + T + G D Sbjct: 416 GAKASSNPTNAGVTNMGVGGGSAVVEGAGAQLIVVARVTSPVGTGTTGED 465 >UniRef50_Q16KA1 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 1003 Score = 31.9 bits (69), Expect = 7.7 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 216 HLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGXKAS 88 H++++ +GSDS + + R R Y K RMA TG AS Sbjct: 297 HISSSESGSDSETSDSPSLLRERHLREKYKKRRMAVGTGKPAS 339 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,417,355 Number of Sequences: 1657284 Number of extensions: 4292267 Number of successful extensions: 10183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10180 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27290400475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -