BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0246 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 110 7e-25 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 36 0.025 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 35 0.032 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 34 0.075 SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 30 1.2 SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_18386| Best HMM Match : CH (HMM E-Value=2.8e-26) 29 1.6 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 29 1.6 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 2.1 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 2.1 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) 29 2.8 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 28 4.9 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 4.9 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 6.5 SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) 27 6.5 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 27 6.5 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 27 8.6 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 27 8.6 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 110 bits (264), Expect = 7e-25 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +1 Query: 256 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWR 402 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWR 106 Score = 67.3 bits (157), Expect = 7e-12 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +2 Query: 83 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAG 253 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AG Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAG 56 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 35.5 bits (78), Expect = 0.025 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +1 Query: 244 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 399 GGW Q WG G+ + R GGG R G +G M GG P W Sbjct: 258 GGWGQGPGGGWGRGQG-RGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 308 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 35.1 bits (77), Expect = 0.032 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = -1 Query: 415 TVPAPARASWGRTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 278 T+P+P+ + R + HH + H + +HHH H H + Sbjct: 198 TMPSPSIVIYRRHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.9 bits (74), Expect = 0.075 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 382 RTYVHHDTCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWF 257 R Y HH C H Y Y+ H H + + H YP RH++ Sbjct: 15 RCYRHHHYCCYCH--HRYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_25421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 329 WVPPPRTRGIRATARPVPHD 270 W+PP RTR R T PV H+ Sbjct: 228 WMPPVRTRPARPTVMPVTHE 247 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 244 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 372 GGW + S WG G R +GGG R G +G GG Sbjct: 6 GGWGRGSGGGWGQGPG-GGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 Query: 244 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 372 GGW + S WG R++GGG R G +G M GG Sbjct: 38 GGWGRGSGGGWG---------RMQGGGMGRGPGGGWGRMQGGG 71 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +1 Query: 244 GGWSQTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 399 GG + WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.5 bits (63), Expect = 1.6 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 334 TYGYHHHGHAEFGQQHVRYPMI-RHWFGTSLLAHAVGLP-RVLGHRNVN 194 +Y +HHHG E Q V I R W L +H P RV+G ++ Sbjct: 21 SYQWHHHGTGETDDQPVTTTRITRTWVNRRLNSHRTIKPSRVIGRAQIH 69 >SB_18386| Best HMM Match : CH (HMM E-Value=2.8e-26) Length = 589 Score = 29.5 bits (63), Expect = 1.6 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -1 Query: 469 SSSNGCCQGRSPLSEVDATVPAPARASWGRTYVHHDTCYRRHPDRTYGY-HHHGH 308 SSS+ S S A + P++ S + H RRH R Y + HHH H Sbjct: 470 SSSSSSSSSSSSSSSTGAQLLTPSKPSSNHNHYHR----RRHHHRNYRHNHHHRH 520 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 370 HHDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 278 HH RH R + +HHH H E+ ++H RY Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH-RY 353 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +1 Query: 211 QELEAALLREQGGWSQTSAESWGTGRA----VARIPR-VRGGGTHRS 336 + E+AL E+ W+Q AES T RA +AR+ R GT RS Sbjct: 3432 EHAESALAAERAQWAQEKAESQNTIRAANEEIARLKEDARKAGTERS 3478 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 379 TYVHHDTCYRRHPDRTYGYHHHGHA 305 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 259 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 375 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 355 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 263 Y +HP T+ YHH H + ++ ++P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 355 YRRHPDRTYGYHHHGHAEFGQQHVRYPMIRH 263 Y +HP T+ YH H + H ++P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 >SB_32896| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-17) Length = 278 Score = 28.7 bits (61), Expect = 2.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 361 TCYRRHPDRTYGYHHHGHAEFGQQHVRYPMIRHWFGTSLL 242 TC+ HP + Y H+ H F Q H + RH+ TS L Sbjct: 52 TCFPYHPHYHHHYRHNDH-YFHQDH----LYRHYLSTSAL 86 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 150 GRGLAAPCTVSLFSEYTDTKGRATDRLI 67 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 382 RTYVH-HDTCYRRHPDRTYGYHHHGHAEFGQQHVRY 278 R Y H CYRR R + YHHH + +RY Sbjct: 216 RCYYHCRRRCYRRR--RRHFYHHHPRRYHNHRRLRY 249 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 407 SARQGFVGANIRPPRHMLPKAP*PDLWVPPP 315 +A F G +RPPRH+ ++P P PPP Sbjct: 316 TALAAFAGPTLRPPRHLPWQSPPPP---PPP 343 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = -1 Query: 448 QGRSP--LSEVDATVPAPARASWGRT--YVHHDTCYRRHPDRTYGYHHHGH 308 +G+SP +V+ P R +T Y HH +RR R + +HHH H Sbjct: 205 KGKSPSLTMKVEDKEAPPIRHLKTKTILYHHHHHHHRRRRRRRHHHHHHHH 255 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 374 RPPRHMLPKAP*PDLWVPPPRTRGIRATARPVPHD 270 RPP H + P PD WVP P R +P D Sbjct: 250 RPPPHHDMRGP-PDQWVPGPEQRRDNMRGPGMPPD 283 >SB_42989| Best HMM Match : HdeA (HMM E-Value=9.6) Length = 235 Score = 27.5 bits (58), Expect = 6.5 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +1 Query: 208 VQELEAALLREQGGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 387 V EL A + R+Q G S E+ R IP+ R GT R+ Q +C ++A Sbjct: 141 VSELLAQVSRDQAGTGTYSVEALENKRVAVDIPK-RLTGTARAQQEVAPALC---TVWAC 196 Query: 388 TKPWRALAPS 417 +P A+ P+ Sbjct: 197 AQPSHAVRPT 206 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYGYHHH 314 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 379 TYVHHDTCYRRHPDRTYGYHHHGHA 305 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYGYHHH 314 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYGYHHHGH 308 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,678,782 Number of Sequences: 59808 Number of extensions: 368984 Number of successful extensions: 1198 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -