BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0245 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B8.09 |||U3 snoRNP-associated protein Utp3 |Schizosaccharom... 27 1.9 SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosac... 27 2.5 >SPBC3B8.09 |||U3 snoRNP-associated protein Utp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 597 Score = 27.1 bits (57), Expect = 1.9 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +2 Query: 5 KNIVEYLKGHQLEDVDVDDLMRR 73 KN+ +Y +G++L+DVD +D + R Sbjct: 374 KNLDDYGEGNRLDDVDAEDKIAR 396 >SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1630 Score = 26.6 bits (56), Expect = 2.5 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 340 MIQLLMDAYKGTLKNXSNESDEKNVGFAMTEEMLKPKGNVXKWTXDELTAQV 495 + +L +D Y LK SN+ + NV TE + K +W LT QV Sbjct: 545 LFELFLDDYFLALKFSSNDQKDDNVSEIPTESLEYKKLRCLRW--KSLTEQV 594 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,954,153 Number of Sequences: 5004 Number of extensions: 34561 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -