BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0244 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 4.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.2 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 8.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 34 QNIINGKTTDADMSSTIMNSSHNKHSIPIDILDD 135 Q+I+N +T + SS+I +S N P L+D Sbjct: 362 QDILNLRTDISSSSSSISSSEENDFWQPKPTLED 395 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 200 KHILTRFPLSSAGRFIMKRLQRSSN 126 KH + + LS RF+ +RL++ +N Sbjct: 106 KHAVHKEQLSREQRFLRRRLEQLTN 130 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 348 VLDNWREYKQTVPTY 392 +LD + +YK+ +P Y Sbjct: 424 ILDYYHKYKENLPKY 438 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 348 VLDNWREYKQTVPTY 392 +LD + +YK+ +P Y Sbjct: 424 ILDYYHKYKENLPKY 438 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 348 VLDNWREYKQTVPTY 392 +LD + +YK+ +P Y Sbjct: 50 ILDYYHKYKENLPKY 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,905 Number of Sequences: 438 Number of extensions: 3152 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -