BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0241 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.3 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 7.3 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.3 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 9.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 634 LMIRHRLPTHLNGGWA 681 L++ P+H+N GW+ Sbjct: 301 LLLEVDAPSHVNAGWS 316 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 192 PCRTWTSPPGPRRRS 148 P R W+SPP R S Sbjct: 121 PRREWSSPPDARAAS 135 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 192 PCRTWTSPPGPRRRS 148 P R W+SPP R S Sbjct: 277 PRREWSSPPDARAAS 291 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +1 Query: 298 PQRTGN*TRRKLSPPASRPCGHARRHC 378 P+R + ++ L+P P G R+C Sbjct: 411 PERFSDENKKNLTPYTYLPFGEGPRNC 437 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 296 DPKGQEIERGASYLRLRPDRVAMQDATAQMAMLQFIS 406 D QE+ YL+L P + A + ++QF++ Sbjct: 1308 DESTQEVHISKEYLQLEPIGLVFVFFFALILVIQFVA 1344 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 296 DPKGQEIERGASYLRLRPDRVAMQDATAQMAMLQFIS 406 D QE+ YL+L P + A + ++QF++ Sbjct: 1308 DESTQEVHISKEYLQLEPIGLVFVFFFALILVIQFVA 1344 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,883 Number of Sequences: 336 Number of extensions: 3783 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -