BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0236 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0419 - 17783202-17784938 29 1.8 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 29 2.4 05_05_0345 - 24237991-24238868,24238956-24239307 27 9.9 04_04_1536 - 34207425-34207490,34207801-34208268,34208345-342084... 27 9.9 >10_08_0419 - 17783202-17784938 Length = 578 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 266 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPN 421 DA + I G+ N+EP + LID + G M++ A A G+ PN Sbjct: 352 DANDWIDGMTERNVEPDVVIYNILIDVYRRLGKMEDAMAVKEAMAKKGISPN 403 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 12/57 (21%) Frame = +2 Query: 173 HGPHXPRPSFGXRKTG------------TRRGILFRASERDHQDAANSIMGIVVENI 307 HGPH P P FG G R G L+ A R D A + + V NI Sbjct: 253 HGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVAVVNI 309 >05_05_0345 - 24237991-24238868,24238956-24239307 Length = 409 Score = 27.1 bits (57), Expect = 9.9 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +1 Query: 259 SPGRGELYNGXSGREHRTSHPLEAAADRRNPQVRXQGPHDVSAQSFCSARTTPQRDYRPV 438 SP L N GR H ++ E D+ P+ R G + +A + T RP+ Sbjct: 274 SPKIRRLVNAMLGRRHGSATASEEHPDKAKPE-RVDGEGEAAAAKQGAPET------RPL 326 Query: 439 PRHPILMS 462 PR+ +L+S Sbjct: 327 PRNGVLIS 334 >04_04_1536 - 34207425-34207490,34207801-34208268,34208345-34208485, 34208582-34208820,34209950-34210436 Length = 466 Score = 27.1 bits (57), Expect = 9.9 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 403 RSRSSGQRHRVDPVXVLEDSVD 338 RSR++G+R+R D V L +SVD Sbjct: 125 RSRAAGERYRHDGVEELPESVD 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,715,089 Number of Sequences: 37544 Number of extensions: 199990 Number of successful extensions: 682 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -