BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0236 (548 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ898279-1|ABI58280.1| 839|Homo sapiens transient receptor pote... 30 6.1 DQ177333-1|ABA06606.1| 850|Homo sapiens transient receptor pote... 30 6.1 DQ177332-1|ABA06605.1| 837|Homo sapiens transient receptor pote... 30 6.1 BC132820-1|AAI32821.1| 839|Homo sapiens transient receptor pote... 30 6.1 AY986821-1|AAX84657.1| 779|Homo sapiens vanilloid receptor vari... 30 6.1 AY131289-1|AAM89472.1| 839|Homo sapiens vanilloid receptor 1 pr... 30 6.1 AJ277028-1|CAB95729.1| 839|Homo sapiens vanilloid receptor 1 pr... 30 6.1 AJ272063-1|CAB89866.2| 839|Homo sapiens vanilloid receptor 1 pr... 30 6.1 AF196175-1|AAG43466.1| 839|Homo sapiens capsaicin receptor prot... 30 6.1 AY894575-1|AAX85114.1| 1214|Homo sapiens NBPF1 protein. 29 8.1 AF379626-1|AAO15394.1| 502|Homo sapiens AC3 protein. 29 8.1 AF379622-1|AAO15391.1| 358|Homo sapiens AB18 protein. 29 8.1 >DQ898279-1|ABI58280.1| 839|Homo sapiens transient receptor potential cation channel subfamily V member 1 transcript var protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >DQ177333-1|ABA06606.1| 850|Homo sapiens transient receptor potential vanilloid 1b protein. Length = 850 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 760 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 789 >DQ177332-1|ABA06605.1| 837|Homo sapiens transient receptor potential vanilloid 1a protein. Length = 837 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 747 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 776 >BC132820-1|AAI32821.1| 839|Homo sapiens transient receptor potential cation channel, subfamily V, member 1 protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >AY986821-1|AAX84657.1| 779|Homo sapiens vanilloid receptor variant TRPV1b protein. Length = 779 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 689 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 718 >AY131289-1|AAM89472.1| 839|Homo sapiens vanilloid receptor 1 protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >AJ277028-1|CAB95729.1| 839|Homo sapiens vanilloid receptor 1 protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >AJ272063-1|CAB89866.2| 839|Homo sapiens vanilloid receptor 1 protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >AF196175-1|AAG43466.1| 839|Homo sapiens capsaicin receptor protein. Length = 839 Score = 29.9 bits (64), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 453 NWVTWNWSIISLGRSPGGAEALGRDIVWTL 364 NW TWN ++ + PG E + R + ++L Sbjct: 749 NWTTWNTNVGIINEDPGNCEGVKRTLSFSL 778 >AY894575-1|AAX85114.1| 1214|Homo sapiens NBPF1 protein. Length = 1214 Score = 29.5 bits (63), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 397 RSSGQRHRVDPVXVLEDSVDQLRLPVDVRFDVLDHYXHYR 278 R SG V+ VL+DS+D+ + F++ D + HYR Sbjct: 1134 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 1173 >AF379626-1|AAO15394.1| 502|Homo sapiens AC3 protein. Length = 502 Score = 29.5 bits (63), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 397 RSSGQRHRVDPVXVLEDSVDQLRLPVDVRFDVLDHYXHYR 278 R SG V+ VL+DS+D+ + F++ D + HYR Sbjct: 422 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 461 >AF379622-1|AAO15391.1| 358|Homo sapiens AB18 protein. Length = 358 Score = 29.5 bits (63), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 397 RSSGQRHRVDPVXVLEDSVDQLRLPVDVRFDVLDHYXHYR 278 R SG V+ VL+DS+D+ + F++ D + HYR Sbjct: 278 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 317 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,247,297 Number of Sequences: 237096 Number of extensions: 984770 Number of successful extensions: 2913 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2913 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -