BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0236 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containi... 29 1.5 At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containi... 29 2.0 At1g01730.1 68414.m00092 expressed protein 29 2.7 At4g20090.1 68417.m02938 pentatricopeptide (PPR) repeat-containi... 28 3.6 At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containi... 28 3.6 At3g49307.1 68416.m05390 Expressed protein 27 8.3 >At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 946 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +2 Query: 221 TRRGILFRASERDHQDAANSIMGIVVEN-IEPHIHWKPQLIDGILKYGDRVHTMSLPRAS 397 T ++ R + QD A+ ++ ++EN P++ ++IDG+ K G L + Sbjct: 670 TYSSLIDRYFKVKRQDLASKVLSKMLENSCAPNVVIYTEMIDGLCKVGKTDEAYKLMQMM 729 Query: 398 APPGLRPNEI 427 G +PN + Sbjct: 730 EEKGCQPNVV 739 >At5g46100.1 68418.m05668 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 472 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 299 ENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEI 427 + IEP++ L+DG+ K G + M L G RPN + Sbjct: 256 KGIEPNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMV 298 >At1g01730.1 68414.m00092 expressed protein Length = 224 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 247 IGTXSPGRGELYNGXSGREHRTSHPL 324 I + PG +Y+G S E+R+SHP+ Sbjct: 186 ITSGGPGTEPVYSGMSKEEYRSSHPI 211 >At4g20090.1 68417.m02938 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 660 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +2 Query: 251 ERDHQDAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEII 430 +R DA + + + H LI G+ K G MSL R A G +PN ++ Sbjct: 340 QRRATDAVRLLSSMEERGYHLNQHIYSVLISGLFKEGKAEEAMSLWRKMAEKGCKPNIVV 399 >At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 825 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 296 VENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEI 427 +E +EP++ LIDG K G V L R + PN+I Sbjct: 708 MEGLEPNVFHYTALIDGYGKLGQMVKVECLLREMHSKNVHPNKI 751 >At3g49307.1 68416.m05390 Expressed protein Length = 76 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 149 GRLLRGEVHGPHXPRP 196 GR G HGPH PRP Sbjct: 54 GRRYPGRPHGPHAPRP 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,049,609 Number of Sequences: 28952 Number of extensions: 146162 Number of successful extensions: 419 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -