BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0235 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0750 + 5574707-5576017 29 2.1 05_01_0475 - 3818121-3820565 28 3.6 11_01_0788 + 6599962-6602700 27 6.3 02_02_0640 - 12528075-12528363,12531326-12532311 27 8.4 >02_01_0750 + 5574707-5576017 Length = 436 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 354 TTNFFLWLAIMFLYDYRRFIYVDKLSIFSCFYYDLVS 244 T FF++ + +FL +RFIY+D L C Y D+ S Sbjct: 302 TKPFFMYKSKLFLGSQKRFIYIDILDGTVC-YVDIPS 337 >05_01_0475 - 3818121-3820565 Length = 814 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232 + + +NPPN YW E S+ ++S N +N NP+ Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245 >11_01_0788 + 6599962-6602700 Length = 912 Score = 27.5 bits (58), Expect = 6.3 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 147 GGLFISIFNEKYLNN--YKYLHDSVLKNRRIVFSMKTLYT*LQGY 19 GGLF S+ E Y+ N YK L D ++ N I + Y L G+ Sbjct: 382 GGLFSSVKLESYIWNEMYKQLGDELVNNDHIRAILNLSYRDLPGH 426 >02_02_0640 - 12528075-12528363,12531326-12532311 Length = 424 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 202 TKYHIALIFSKYKPIALIWRVVHIH 128 +K +AL F Y P A +WRV+ H Sbjct: 381 SKKRLALEFQVYNPAAKMWRVLTTH 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,174,590 Number of Sequences: 37544 Number of extensions: 189687 Number of successful extensions: 364 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -